SIX6 Antibody - BSA Free

Western Blot: SIX6 Antibody [NBP1-82478] - Analysis in human eye tissue.

Immunocytochemistry/Immunofluorescence: SIX6 Antibody [NBP1-82478] - Staining of human cell line SH-SY5Y shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: SIX6 Antibody [NBP1-82478] - Staining of human pituitary gland shows moderate nuclear positivity.

Immunohistochemistry-Paraffin: SIX6 Antibody [NBP1-82478] -Staining of human cerebral cortex shows strong nuclear positivity in neurons.

Immunohistochemistry-Paraffin: SIX6 Antibody [NBP1-82478] - Staining of human skeletal muscle shows strong nuclear positivity in myocytes.

Immunohistochemistry-Paraffin: SIX6 Antibody [NBP1-82478] -Staining of human tonsil shows negative nuclear positivity in non-germinal center cells as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SIX6 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SIX6 Antibody - BSA Free (NBP1-82478) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-SIX6 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: YQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRNLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNRLQQQVLSQGSGRALRAEGDGTPEVLGVATSPAASLSSKAATSAISITSSDSECDI
• Predicted Species: Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SIX6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SIX6 Recombinant Protein Antigen (NBP1-82478PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SIX6 Antibody - BSA Free

• homeobox protein SIX6
• Homeodomain protein OPTX2
• MCOPCT2
• Optic homeobox 2
• OPTX2
• sine oculis homeobox (Drosophila) homolog 6
• sine oculis homeobox homolog 6 (Drosophila)
• Sine oculis homeobox homolog 6
• SIX homeobox 6
• Six9

Background

The protein encoded by the Homeobox protein SIX6 gene is a homeobox protein that is similar to the Drosophila 'sine oculis' gene product. This gene is found in a cluster of related genes on chromosome 14 and is thought to be involved in eye development. Defects in this gene are a cause of isolated microphthalmia with cataract type 2 (MCOPCT2). (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SIX6 Antibody (NBP1-82478)(1)

Publication using NBP1-82478

• Lee EJ, Kim N, Park JW et al. Global Analysis of Intercellular Homeodomain Protein Transfer Cell Rep 2019-07-16 [PMID: 31315049]

Bioinformatics

• Gene Symbol: SIX6