SIX5 Antibody

Images

 
Immunohistochemistry-Paraffin: SIX5 Antibody [NBP1-85009] - Moderately differentiated mouse adenocarcinomas show moderate nuclear Six5 expression. IHC-P image submitted by a verified customer review.
Immunohistochemistry-Paraffin: Six5 Antibody [NBP1-85009] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SIX5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VVPTSQVVTLPQAVGPLQLLAAGPGSPVKVAAAAGPANVHLINSGVGVTALQLPSATAPGNFLLANPVSGSPIVTGVAVQQGKIILTATFPTSMLVSQVLP
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SIX5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SIX5 Recombinant Protein Antigen (NBP1-85009PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-85009 in the following applications:

Reactivity Notes

Mouse reactivity reported from a verified customer review.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SIX5 Antibody

  • BOR2
  • DM locus-associated homeodomain protein
  • DMAHPsine oculis homeobox homolog 5 (Drosophila)
  • dystrophia myotonica-associated homeodomain protein
  • homeobox protein SIX5
  • sine oculis homeobox (Drosophila) homolog 5
  • Sine oculis homeobox homolog 5
  • SIX homeobox 5

Background

Six5 (homeobox protein SIX5), also known as SIX5, BOR2 or DMAHP (DM locus-associated homeodomain protein), is a transcription factor that is expressed in various structures of the adult eye. Localized to the cytoplasm in early development and to the nucleus in the later stages of development,Six5 is involved in regulation of organogenesis and in maintenance of retinal formation. Six5 is able to bind the 5'-TCA[AG][AG]TTNC-3' DNA sequence found in the myogenin and IGFBP5 promoters and, through this binding, can control transcription of the associated mRNA. Six5 is regulated via association with DACH1 (dachshund homolog 1) and is co-activated by the EYA (eyes absent) proteins. Defects in the gene encoding Six5 are the cause of branchiooto- renal syndrome type 2 (BOR2), an autosomal disorder characterized by hearing loss, a deep overbite and myopia. Two isoforms exist due to alternative splicing events.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB6967
Species: Hu
Applications: WB
NBP2-87382
Species: Hu
Applications: IHC, IHC-P, WB
H00051804-M09
Species: Hu
Applications: ELISA, ICC/IF, KD, WB
NBP1-84264
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, KD, WB
NB100-95001
Species: Hu
Applications: IHC, IHC-P, IP, WB
NB100-56510
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-42632
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
NBP1-52030
Species: Hu
Applications: PEP-ELISA, WB
H00010736-M01
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, KD, WB
H00006496-M04
Species: Hu
Applications: ELISA, WB
NBP1-89951
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
NB100-360
Species: Hu, Mu, Rt
Applications: IB, ICC/IF, IHC, IHC-P, IP, WB
NBP1-84026
Species: Hu
Applications: IHC, IHC-P, WB
MAB2457
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP2-49409
Species: Hu
Applications: IHC, IHC-P
NBP1-85009
Species: Hu, Mu, Rt
Applications: IHC

Publications for SIX5 Antibody (NBP1-85009) (0)

There are no publications for SIX5 Antibody (NBP1-85009).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for SIX5 Antibody (NBP1-85009) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP1-85009:
Filter by Applications
IHC-P
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Paraffin SIX5 NBP1-85009
Enlarge
5
reviewed by:
Verified Customer
IHC-P Mouse 02/28/2021
View

Summary

ApplicationImmunohistochemistry-Paraffin
Sample Testedadenocarcinomas
SpeciesMouse
LotR38607

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SIX5 Antibody (NBP1-85009) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Verified Customer
02/28/2021
Application: IHC-P
Species: Mouse

Bioinformatics

Gene Symbol SIX5