SIVA Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SIVA Antibody [NBP2-56374] - Staining of human cell line MCF7 shows localization to nucleoplasm.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SIVA Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IRSLGQASEADPSGVASIACSSCVRAVDGKAVCGQCERALCGQCVRTCWGCGSVACT
Specificity
Specificity of human SIVA antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SIVA1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SIVA Recombinant Protein Antigen (NBP2-56374PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SIVA Antibody

  • CD27-binding (Siva) protein
  • CD27BPCD27-binding protein
  • Siva-1
  • SIVA1, apoptosis-inducing factor
  • Siva-2
  • SIVAapoptosis regulatory protein Siva

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56104
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-Fr, IHC-P, IP
AF382
Species: Hu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, Neut
NBP2-17262
Species: Hu
Applications: WB, ICC/IF
NB100-56708
Species: Hu, Mu, Rt, Po, Ch, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, HEStain, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, IHC-FrFl, KD, KO
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-56583
Species: Hu, Rt, Rb
Applications: WB, Flow, IHC, IHC-P, KO
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-28566
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, Flow, Func, IHC, IHC-Fr
NB100-56098
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
NB100-56503
Species: Hu, Mu, Rt, Dr, Rb
Applications: WB, Simple Western, Flow, IB, ICC/IF, IHC, IHC-P, Flow-CS, Flow-IC
MAB2738
Species: Hu
Applications: Flow
NB100-56370
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB5938
Species: Hu
Applications: WB, ICC
H00006296-D01P
Species: Hu, Mu
Applications: WB
MAB689
Species: Hu
Applications: WB, Flow, Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
AF860
Species: Hu, Mu
Applications: WB, Simple Western, IP
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NB100-2736
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP2-56374
Species: Hu
Applications: ICC/IF

Publications for SIVA Antibody (NBP2-56374) (0)

There are no publications for SIVA Antibody (NBP2-56374).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SIVA Antibody (NBP2-56374) (0)

There are no reviews for SIVA Antibody (NBP2-56374). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SIVA Antibody (NBP2-56374) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SIVA Products

Bioinformatics Tool for SIVA Antibody (NBP2-56374)

Discover related pathways, diseases and genes to SIVA Antibody (NBP2-56374). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SIVA Antibody (NBP2-56374)

Discover more about diseases related to SIVA Antibody (NBP2-56374).
 

Pathways for SIVA Antibody (NBP2-56374)

View related products by pathway.

PTMs for SIVA Antibody (NBP2-56374)

Learn more about PTMs related to SIVA Antibody (NBP2-56374).
 

Research Areas for SIVA Antibody (NBP2-56374)

Find related products by research area.

Blogs on SIVA

There are no specific blogs for SIVA, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SIVA Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SIVA1