We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

SIRP alpha/CD172a Antibody - BSA Free

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: SIRP alpha/CD172a Antibody [NBP2-58429] - Analysis in human cerebral cortex and skeletal muscle tissues using NBP2-58429 antibody. Corresponding SIRPA RNA-seq ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: SIRP alpha/CD172a Antibody [NBP2-58429] - Staining of human cerebellum, cerebral cortex, pancreas and skeletal muscle using Anti-SIRPA antibody NBP2-58429 ...read more
Immunohistochemistry-Paraffin: SIRP alpha/CD172a Antibody [NBP2-58429] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: SIRP alpha/CD172a Antibody [NBP2-58429] - Staining of human cerebral cortex shows strong positivity in neuropil.
Immunohistochemistry-Paraffin: SIRP alpha/CD172a Antibody [NBP2-58429] - Staining of human cerebellum shows strong cytoplasmic positivity in cells in granular layer.
Immunohistochemistry-Paraffin: SIRP alpha/CD172a Antibody [NBP2-58429] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

SIRP alpha/CD172a Antibody - BSA Free Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NNHTEYASIQTSPQPASEDTLTYADLDMVHLNRTPKQPAPKPEPSFSEYASVQVPRK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SIRPA
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SIRP alpha/CD172a Recombinant Protein Antigen (NBP2-58429PEP)

Reactivity Notes

Mouse 81%, Rat 81%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SIRP alpha/CD172a Antibody - BSA Free

  • BIT
  • BITbrain-immunoglobulin-like molecule with tyrosine-based activation motifs
  • Brain Ig-like molecule with tyrosine-based activation motifs
  • CD172 antigen-like family member A
  • CD172a antigen
  • CD172a
  • Inhibitory receptor SHPS-1
  • Macrophage fusion receptor
  • MFR
  • MFRtyrosine phosphatase SHP substrate 1
  • MyD-1 antigen
  • MYD1
  • MYD-1
  • P84
  • protein tyrosine phosphatase, non-receptor type substrate 1
  • PTPNS1
  • SHP substrate 1
  • SHPS1
  • SHPS-1
  • SHPS1CD172A
  • signal-regulatory protein alpha
  • Signal-regulatory protein alpha-1
  • Signal-regulatory protein alpha-2
  • Signal-regulatory protein alpha-3
  • SIRP alpha
  • SIRPA
  • SIRPalpha
  • Sirp-alpha-1
  • SIRPalpha2
  • Sirp-alpha-2
  • Sirp-alpha-3
  • SIRPtyrosine-protein phosphatase non-receptor type substrate 1

Background

Protein tyrosine phosphatases (PTPases) SHP-1 and SHP-2 are critical regulators in the intracellular signaling pathways that result in cell responses such as mitosis, differentiation, migration, survival, transformation or death. SHP-2 is a signal transducer for several receptor tyrosine kinases and cytokine receptors. A novel SHP-2 associated glycoprotein was recently cloned from human, rat, mouse and cattle by several labs and was designated SIRPa (1), SHPS-1 (2,3), MyD-1 (4), BIT (5,6) and p84 (7). SIRPa is a new gene family containing at least fifteen members. SIRPa is a substrate of many activated tyrosine kinases such as insulin receptor, EGFR, PDGFR and src, and a specific docking protein for SHP-2 (1,2,5,8). SIRPa has regulatory effects on cellular responses induced by serum, growth factors, insulin, oncogenes, growth hormones and cell adhesion and plays a general role in different physiological and pathological processes (1,2,5,8).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-31106
Species: Hu, Mu
Applications: CyTOF-ready, Flow-CS, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NB100-2682
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow-CS, Flow, ICC/IF, IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-79709
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
7268-CT
Species: Hu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-83276
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
AF3790
Species: Hu, Mu
Applications: ICC, Simple Western, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP1-92684
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP3-12897
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-93743
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
DC140
Species: Hu
Applications: ELISA
NBP1-49045
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
NB110-89474
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, ISH, Simple Western, Single-Cell Western, WB
DBD00
Species: Hu
Applications: ELISA

Publications for SIRP alpha/CD172a Antibody (NBP2-58429) (0)

There are no publications for SIRP alpha/CD172a Antibody (NBP2-58429).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SIRP alpha/CD172a Antibody (NBP2-58429) (0)

There are no reviews for SIRP alpha/CD172a Antibody (NBP2-58429). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SIRP alpha/CD172a Antibody (NBP2-58429) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SIRP alpha/CD172a Products

Research Areas for SIRP alpha/CD172a Antibody (NBP2-58429)

Find related products by research area.

Blogs on SIRP alpha/CD172a

There are no specific blogs for SIRP alpha/CD172a, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SIRP alpha/CD172a Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol SIRPA