SIN3A Antibody (1Z7Y1)

Western Blot: SIN3A Antibody (1Z7Y1) [NBP3-33359] - Western blot analysis of various lysates, using SIN3A Rabbit mAb at 1:2000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clone: 1Z7Y1
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

SIN3A Antibody (1Z7Y1) Summary

• Description: Novus Biologicals Rabbit SIN3A Antibody (1Z7Y1) (NBP3-33359) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SIN3A (NP_056292.1).
  
  Sequence:
  MKRRLDDQESPVYAAQQRRIPGSTEAFPHQHRVLAPAPPVYEAVSETMQSATGIQYSVTPSYQVSAMPQSSGSHGPAIAAVHSSHHHPTAVQPHGGQVVQ
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: SIN3A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:1000 - 1:5000
• Theoretical MW: 145 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for SIN3A Antibody (1Z7Y1)

• DKFZp434K2235
• FLJ90319
• Histone deacetylase complex subunit Sin3a
• KIAA0700
• paired amphipathic helix protein Sin3a
• SIN3 homolog A, transcription regulator (yeast)
• SIN3 homolog A, transcriptional regulator (yeast)
• SIN3A
• Transcriptional corepressor Sin3a
• transcriptional co-repressor Sin3A
• transcriptional regulator, SIN3A

Background

Sin3A is encoded by this gene is a transcriptional regulatory protein. It contains paired amphipathic helix (PAH) domains, which are important for protein-protein interactions and may mediate repression by the Mad-Max complex.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SIN3A