Sin1/MAPKAP1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Sin1/MAPKAP1 Antibody [NBP1-89568] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: Sin1/MAPKAP1 Antibody [NBP1-89568] - Staining of human heart muscle shows moderate cytoplasmic positivity in myocytes.
Immunohistochemistry: Sin1/MAPKAP1 Antibody [NBP1-89568] - Staining of human lateral ventricle shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Sin1/MAPKAP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ATVQDMLSSHHYKSFKVSMIHRLRFTTDVQLGISGDKVEIDPVTNQKASTKFWIKQKPISIDSDLLCACDLAEEKSPSHAIFKLTYLSNHDYKHLYFESDAATVNEIVLKVNYILESRASTARADYFAQKQRKLNRRTSFSFQKEKKSGQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAPKAP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10 - 1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Sin1/MAPKAP1 Protein (NBP1-89568PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Sin1/MAPKAP1 Antibody

  • JC310
  • MAPKAP1
  • MEKK2-interacting protein 1
  • MGC2745
  • MIP1
  • MIP1SIN1SIN1b
  • Mitogen-activated protein kinase 2-associated protein 1
  • mitogen-activated protein kinase associated protein 1
  • mSIN1
  • ras inhibitor MGC2745
  • SAPK-interacting protein 1
  • Sin1
  • SIN1g
  • stress-activated map kinase interacting protein 1
  • Stress-activated map kinase-interacting protein 1
  • stress-activated protein kinase-interacting 1
  • target of rapamycin complex 2 subunit MAPKAP1
  • TORC2 subunit MAPKAP1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-611
Species: Hu
Applications: WB, IP
NBP2-22356
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-331
Species: Hu, Mu, Rt
Applications: IP (-), WB
AF4004
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-89865
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24449
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF8962
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-20308
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-45861
Species: Hu
Applications: WB, Flow, IHC, IF
NBP2-58661
Species: Hu
Applications: IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Sin1/MAPKAP1 Antibody (NBP1-89568) (0)

There are no publications for Sin1/MAPKAP1 Antibody (NBP1-89568).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Sin1/MAPKAP1 Antibody (NBP1-89568) (0)

There are no reviews for Sin1/MAPKAP1 Antibody (NBP1-89568). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Sin1/MAPKAP1 Antibody (NBP1-89568) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Sin1/MAPKAP1 Products

Bioinformatics Tool for Sin1/MAPKAP1 Antibody (NBP1-89568)

Discover related pathways, diseases and genes to Sin1/MAPKAP1 Antibody (NBP1-89568). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Sin1/MAPKAP1 Antibody (NBP1-89568)

Discover more about diseases related to Sin1/MAPKAP1 Antibody (NBP1-89568).
 

Pathways for Sin1/MAPKAP1 Antibody (NBP1-89568)

View related products by pathway.

PTMs for Sin1/MAPKAP1 Antibody (NBP1-89568)

Learn more about PTMs related to Sin1/MAPKAP1 Antibody (NBP1-89568).
 

Research Areas for Sin1/MAPKAP1 Antibody (NBP1-89568)

Find related products by research area.

Blogs on Sin1/MAPKAP1

There are no specific blogs for Sin1/MAPKAP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Sin1/MAPKAP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAPKAP1
Entrez