Signal Peptide Peptidase Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Signal Peptide Peptidase Antibody [NBP2-54935] - Staining of human cell line U-2 OS shows localization to endoplasmic reticulum.

• Reactivity: Hu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Signal Peptide Peptidase Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Signal Peptide Peptidase Antibody - BSA Free (NBP2-54935) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KGEVTEMFSYEESNPKDPAAVTESKEGTEASASKGLEKKEK
• Predicted Species: Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HM13
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Signal Peptide Peptidase Recombinant Protein Antigen (NBP2-54935PEP)

Reactivity Notes

Mouse 88%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Signal Peptide Peptidase Antibody - BSA Free

• dJ324O17.1
• EC 3.4.23.-
• H13hIMP1
• histocompatibility (minor) 13
• IMP-1
• IMP1MSTP086
• Intramembrane protease 1
• minor histocompatibility antigen 13
• minor histocompatibility antigen H13
• Presenilin-like protein 3
• PSENL3
• PSL3IMPAS
• signal peptide peptidase beta
• Signal peptide peptidase
• SPPIMPAS-1

Background

Signal Peptide Peptidase is encoded by this gene, which localizes to the endoplasmic reticulum, catalyzes intramembrane proteolysis of some signal peptides after they have been cleaved from a preprotein. This activity is required to generate signal sequence-derived human lymphocyte antigen-E epitopes that are recognized by the immune system, and to process hepatitis C virus core protein. The encoded protein is an integral membrane protein with sequence motifs characteristic of the presenilin-type aspartic proteases. Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HM13