Signal Peptide Peptidase Antibody

Images

 
Western Blot: Signal Peptide Peptidase Antibody [NBP1-74111] - Mouse Spleen Lysate 1ug/ml Gel Concentration 12%

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Signal Peptide Peptidase Antibody Summary

Immunogen
Synthetic peptides corresponding to the middle region of H13. Immunizing peptide sequence IKLVFPQDLLEKGLEADNFAMLGLGDIVIPGIFIALLLRFDISLKKNTHT.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HM13
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against H13 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Signal Peptide Peptidase Antibody

  • dJ324O17.1
  • EC 3.4.23.-
  • H13hIMP1
  • histocompatibility (minor) 13
  • IMP-1
  • IMP1MSTP086
  • Intramembrane protease 1
  • minor histocompatibility antigen 13
  • minor histocompatibility antigen H13
  • Presenilin-like protein 3
  • PSENL3
  • PSL3IMPAS
  • signal peptide peptidase beta
  • Signal peptide peptidase
  • SPPIMPAS-1

Background

H13 catalyzes intramembrane proteolysis of some signal peptides after they have been cleaved from a preprotein, resulting in the release of the fragment from the ER membrane into the cytoplasm. It is required to generate lymphocyte cell surface (HLA-E) epitopes derived from MHC class I signal peptides. Involved in the intramembrane cleavage of the integral membrane protein PSEN1 By similarity. It may play a role in graft rejection.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38956
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-02627
Species: Hu, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-91705
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-83107
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-22568
Species: Hu
Applications: IHC-P
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
MAB7089
Species: Mu
Applications: Flow, IHC, CyTOF-ready
NBP1-87512
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-38877
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-84339
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74512
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-32505
Species: Hu
Applications: IHC, IHC-P
MAB4077
Species: Hu
Applications: WB, IHC

Publications for Signal Peptide Peptidase Antibody (NBP1-74111) (0)

There are no publications for Signal Peptide Peptidase Antibody (NBP1-74111).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Signal Peptide Peptidase Antibody (NBP1-74111) (0)

There are no reviews for Signal Peptide Peptidase Antibody (NBP1-74111). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Signal Peptide Peptidase Antibody (NBP1-74111) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Signal Peptide Peptidase Products

Bioinformatics Tool for Signal Peptide Peptidase Antibody (NBP1-74111)

Discover related pathways, diseases and genes to Signal Peptide Peptidase Antibody (NBP1-74111). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Signal Peptide Peptidase Antibody (NBP1-74111)

Discover more about diseases related to Signal Peptide Peptidase Antibody (NBP1-74111).
 

Pathways for Signal Peptide Peptidase Antibody (NBP1-74111)

View related products by pathway.

Blogs on Signal Peptide Peptidase

There are no specific blogs for Signal Peptide Peptidase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Signal Peptide Peptidase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HM13
Uniprot