Sigma-1 R/OPRS1 Antibody

Images

 
Immunohistochemistry-Paraffin: Sigma-1 R/OPRS1 Antibody [NBP1-82480] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Sigma-1 R/OPRS1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: HSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTY
Specificity
Specificity of human Sigma-1 R/OPRS1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SIGMAR1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Sigma-1 R/OPRS1 Protein (NBP1-82480PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Sigma-1 R/OPRS1 Antibody

  • Aging-associated gene 8 protein
  • ALS16
  • FLJ25585
  • hSigmaR1
  • OPRS1
  • SIG-1R
  • sigma 1
  • Sigma 1-type opioid receptor
  • sigma non-opioid intracellular receptor 1
  • Sigma-1 R
  • sigma1 receptor
  • Sigma1R
  • Sigma-1R
  • sigma1-receptor
  • SIGMAR1
  • SR31747 binding protein 1
  • SR31747-binding protein
  • SRBP
  • SR-BP
  • SR-BP1
  • SRBPMGC3851
  • type I sigma receptor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NBP1-59744
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-56583
Species: Hu
Applications: WB, Flow, IHC-P
248-BD
Species: Hu, Mu, Rt, Ca, Eq
AF1543
Species: Hu
Applications: WB, IHC
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
H00005545-R02
Species: Hu
NBP1-89113
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
H00006532-D01P
Species: Hu, Mu
Applications: WB
NBP2-66861
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
H00009354-M08
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF

Publications for Sigma-1 R/OPRS1 Antibody (NBP1-82480) (0)

There are no publications for Sigma-1 R/OPRS1 Antibody (NBP1-82480).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Sigma-1 R/OPRS1 Antibody (NBP1-82480) (0)

There are no reviews for Sigma-1 R/OPRS1 Antibody (NBP1-82480). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Sigma-1 R/OPRS1 Antibody (NBP1-82480) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Sigma-1 R/OPRS1 Antibody (NBP1-82480)

Discover related pathways, diseases and genes to Sigma-1 R/OPRS1 Antibody (NBP1-82480). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Sigma-1 R/OPRS1 Antibody (NBP1-82480)

Discover more about diseases related to Sigma-1 R/OPRS1 Antibody (NBP1-82480).
 

Pathways for Sigma-1 R/OPRS1 Antibody (NBP1-82480)

View related products by pathway.

PTMs for Sigma-1 R/OPRS1 Antibody (NBP1-82480)

Learn more about PTMs related to Sigma-1 R/OPRS1 Antibody (NBP1-82480).

Blogs on Sigma-1 R/OPRS1

There are no specific blogs for Sigma-1 R/OPRS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Sigma-1 R/OPRS1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SIGMAR1
Entrez