Sialin/SLC17A5 Antibody

Images

 
Western Blot: Sialin/SLC17A5 Antibody [NBP1-59788] - Titration: 0.5ug/ml Positive Control: 293T cells lysate.
Immunohistochemistry-Paraffin: Sialin/SLC17A5 Antibody [NBP1-59788] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Sialin/SLC17A5 Antibody Summary

Immunogen
Synthetic peptides corresponding to SLC17A5(solute carrier family 17 (anion/sugar transporter), member 5) The peptide sequence was selected from the N terminal of SLC17A5. Peptide sequence LFTPIAADLGVGPLIVLRALEGLGEGVTFPAMHAMWSSWAPPLERSKLLS
Clonality
Polyclonal
Host
Rabbit
Gene
SLC17A5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against SLC17A5 and was validated on Western Blot and immunohistochemistry-paraffin

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Sialin/SLC17A5 Antibody

  • AST
  • ASTSodium/sialic acid cotransporter
  • FLJ22227
  • FLJ23268
  • ISSD
  • Membrane glycoprotein HP59
  • NSD
  • SD
  • sialic acid storage disease
  • Sialin
  • SIASD
  • SLC17A5
  • SLD
  • SLDSolute carrier family 17 member 5
  • solute carrier family 17 (anion/sugar transporter), member 5
  • solute carrier family 17, member 5

Background

SLC17A5 is a membrane transporter that exports free sialic acids that have been cleaved off of cell surface lipids and proteins from lysosomes. Mutations in SLC17A5 gene cause sialic acid storage diseases, including infantile sialic acid storage disorder and and Salla disease, an adult form.This gene encodes a membrane transporter that exports free sialic acids that have been cleaved off of cell surface lipids and proteins from lysosomes. Mutations in this gene cause sialic acid storage diseases, including infantile sialic acid storage disorder and and Salla disease, an adult form. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP2-42378
Species: Hu
Applications: WB, IHC
NB110-3638
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP2-32263
Species: Hu
Applications: WB, IHC, IP
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89134
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00002678-M01
Species: Hu, Mu
Applications: WB, ELISA, IHC-P, IP
NBP2-54724
Species: Hu
Applications: WB, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
H00005555-P01
Species: Hu
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Sialin/SLC17A5 Antibody (NBP1-59788) (0)

There are no publications for Sialin/SLC17A5 Antibody (NBP1-59788).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Sialin/SLC17A5 Antibody (NBP1-59788) (0)

There are no reviews for Sialin/SLC17A5 Antibody (NBP1-59788). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Sialin/SLC17A5 Antibody (NBP1-59788) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Sialin/SLC17A5 Antibody Products

Related Products by Gene

Bioinformatics Tool for Sialin/SLC17A5 Antibody (NBP1-59788)

Discover related pathways, diseases and genes to Sialin/SLC17A5 Antibody (NBP1-59788). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Sialin/SLC17A5 Antibody (NBP1-59788)

Discover more about diseases related to Sialin/SLC17A5 Antibody (NBP1-59788).
 

Pathways for Sialin/SLC17A5 Antibody (NBP1-59788)

View related products by pathway.

PTMs for Sialin/SLC17A5 Antibody (NBP1-59788)

Learn more about PTMs related to Sialin/SLC17A5 Antibody (NBP1-59788).

Blogs on Sialin/SLC17A5

There are no specific blogs for Sialin/SLC17A5, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Sialin/SLC17A5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC17A5
Entrez
Uniprot

Customers Who Bought This Also Bought