Sialin/SLC17A5 Antibody


Western Blot: Sialin/SLC17A5 Antibody [NBP1-59788] - Titration: 0.5ug/ml Positive Control: 293T cells lysate.
Immunohistochemistry-Paraffin: Sialin/SLC17A5 Antibody [NBP1-59788] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

Sialin/SLC17A5 Antibody Summary

Synthetic peptides corresponding to SLC17A5(solute carrier family 17 (anion/sugar transporter), member 5) The peptide sequence was selected from the N terminal of SLC17A5. Peptide sequence LFTPIAADLGVGPLIVLRALEGLGEGVTFPAMHAMWSSWAPPLERSKLLS
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against SLC17A5 and was validated on Western Blot and immunohistochemistry-paraffin
Positive Control
Sialin/SLC17A5 Lysate (NBP2-66099)

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Sialin/SLC17A5 Antibody

  • AST
  • ASTSodium/sialic acid cotransporter
  • FLJ22227
  • FLJ23268
  • ISSD
  • Membrane glycoprotein HP59
  • NSD
  • SD
  • sialic acid storage disease
  • Sialin
  • SLC17A5
  • SLD
  • SLDSolute carrier family 17 member 5
  • solute carrier family 17 (anion/sugar transporter), member 5
  • solute carrier family 17, member 5


SLC17A5 is a membrane transporter that exports free sialic acids that have been cleaved off of cell surface lipids and proteins from lysosomes. Mutations in SLC17A5 gene cause sialic acid storage diseases, including infantile sialic acid storage disorder and and Salla disease, an adult form.This gene encodes a membrane transporter that exports free sialic acids that have been cleaved off of cell surface lipids and proteins from lysosomes. Mutations in this gene cause sialic acid storage diseases, including infantile sialic acid storage disorder and and Salla disease, an adult form. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
Species: Hu
Applications: WB, IHC, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
Species: Hu
Species: Hu
Applications: WB, IHC, ICC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Sialin/SLC17A5 Antibody (NBP1-59788) (0)

There are no publications for Sialin/SLC17A5 Antibody (NBP1-59788).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Sialin/SLC17A5 Antibody (NBP1-59788) (0)

There are no reviews for Sialin/SLC17A5 Antibody (NBP1-59788). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Sialin/SLC17A5 Antibody (NBP1-59788) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional Sialin/SLC17A5 Products

Bioinformatics Tool for Sialin/SLC17A5 Antibody (NBP1-59788)

Discover related pathways, diseases and genes to Sialin/SLC17A5 Antibody (NBP1-59788). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Sialin/SLC17A5 Antibody (NBP1-59788)

Discover more about diseases related to Sialin/SLC17A5 Antibody (NBP1-59788).

Pathways for Sialin/SLC17A5 Antibody (NBP1-59788)

View related products by pathway.

PTMs for Sialin/SLC17A5 Antibody (NBP1-59788)

Learn more about PTMs related to Sialin/SLC17A5 Antibody (NBP1-59788).

Blogs on Sialin/SLC17A5

There are no specific blogs for Sialin/SLC17A5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Sialin/SLC17A5 Antibody and receive a gift card or discount.


Gene Symbol SLC17A5