Shugoshin Antibody (3C11)

Images

 
Western Blot: Shugoshin Antibody (3C11) [H00151648-M01] - Analysis of SGOL1 expression in transfected 293T cell line by SGOL1 monoclonal antibody (M01), clone 3C11.Lane 1: SGOL1 transfected lysate(33.5 KDa).Lane 2: ...read more
Immunoprecipitation: Shugoshin Antibody (3C11) [H00151648-M01] - Analysis of SGOL1 transfected lysate using anti-SGOL1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SGOL1 MaxPab rabbit ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, Func, ICC/IF, IHC, IHC-P, IP
Clone
3C11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Shugoshin Antibody (3C11) Summary

Immunogen
SGOL1 (AAH17867, 1 a.a. ~ 292 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAKERCLKKSFQDSLEDIKKRMKEKRNKNLAEIGKRRSFIAAPCQIITNTSTLLKNYQDNNKMLVLALENEKSKVKEAQDIILQLRKECYYLTCQLYALKGKLTSQQTVEPAQNQEICSSGMDPNSDDSSRNLFVKDLPQIPLEETELPGQGESFQIEATPPETQQSPHLSLKDITNVSLYPVVKIRRLSLSPKKNKASPAVALPKRRCTASVNYKEPTLASKLRRGDPFTDLCFLNSPIFKQKKDLRRSKKRALEVSPAKEAIFILYYVREFVSRFPDCRKCKLETHICLR
Localization
Nuclear. Localizes to the centromere. BUB1 is required for centromeric localization.
Specificity
SGOL1 - shugoshin-like 1 (S. pombe)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SGO1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA 1:100-1:2000
  • Functional
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation 1:10-1:500
Application Notes
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID: 26670547).
Publications
Read Publications using H00151648-M01.

Reactivity Notes

Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Shugoshin Antibody (3C11)

  • FLJ14230
  • hSgo1
  • NY-BR-85
  • Serologically defined breast cancer antigen NY-BR-85
  • SGO
  • Sgo1
  • shugoshin 1AB protein
  • shugoshin 1CD protein
  • shugoshin 1EF protein
  • shugoshin 1GH protein
  • shugoshin 1KL protein
  • shugoshin-like 1 (S. pombe)
  • shugoshin-like 1

Background

Shugoshin (Sgo) proteins constitute a conserved protein family defined as centromeric protectors of Rec8-containing cohesin complexes in meiosis. It has been demonstrated that vertebrate shugoshin is required for preserving centromeric cohesion during mitosis. The presence of human Scc1 at centromeres in mitosis is dependent on human Sgo1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-330
Species: Hu
Applications: ICC/IF
NBP2-20053
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-56651
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00000699-D01P
Species: Hu, Mu
Applications: WB, ICC/IF, PLA
NBP2-37530
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB100-60454
Species: Hu
Applications: IP
NB100-294
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, MiAr
NBP1-87145
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-563
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-26626
Species: Hu
Applications: WB, IHC, IHC-P, IP
MAB1934
Species: Hu
Applications: WB, Flow, IP, CyTOF-ready
NBP2-67349
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-37471
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
AF8198
Species: Hu
Applications: ELISA, IHC
NBP1-92579
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2359
Species: Hu
Applications: WB, IHC, IP
NB100-353
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP1-32775
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB500-201
Species: Hu, Mu, Rt, Ca, Fe, Gp, Ha
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Dual ISH-IHC, KD
NBP1-30141
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP

Publications for Shugoshin Antibody (H00151648-M01)(17)

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(1)
WB
(1)
All Applications
Filter By Species
All Species
Showing Publications 1 - 10 of 17. Show All 17 Publications.
Publications using H00151648-M01 Applications Species
Vallardi G, Allan LA, Crozier L, Saurin AT et al. Division of labour between PP2A-B56 isoforms at the centromere and kinetochore. Elife. 2019 Mar 04 [PMID: 30829571]
Liang C, Zhang Z, Chen Q et al. A positive feedback mechanism ensures proper assembly of the functional inner centromere during mitosis in human cells. J Biol Chem. 2018 Nov 29 [PMID: 30498087]
Zielinska AP, Holubcova Z, Blayney M et al. Sister kinetochore splitting and precocious disintegration of bivalents could explain the maternal age effect. Elife 2015 Dec 15 [PMID: 26670547] (ICC/IF) ICC/IF
Asghar A, Lajeunesse A, Dulla K et al. Bub1 autophosphorylation feeds back to regulate kinetochore docking and promote localized substrate phosphorylation. Nat Commun 2015 Sep 24 [PMID: 26399325] (WB) WB
C. van de Werken1, M. Avo Santos, J.S.E. Laven et al. Chromosome segregation regulation in human zygotes: altered mitotic histone phosphorylation dynamics underlying centromeric targeting of the chromosomal passenger complex. Hum Reprod Jun 22 2015
Song AT, Galli A, Leclerc S et al. Dataset of Sgo1 expression in cardiac, gastrointestinal, hepatic and neuronal tissue in mouse. Data Brief 2017 Jul 1 [PMID: 28748208]
C. van de Werken1, M. Avo Santos, J.S.E. Laven et al. Chromosome segregation regulation in human zygotes: altered mitotic histone phosphorylation dynamics underlying centromeric targeting of the chromosomal passenger complex. Hum Reprod. 2015 Jul 29 [PMID: 26223676]
Nijenhuis W, Vallardi G, Teixeira A et al. Negative feedback at kinetochores underlies a responsive spindle checkpoint signal. Nat Cell Biol. 2014 Nov 17 [PMID: 25402682]
Garcia-Cruz R, Brieno MA, Roig I et al. Dynamics of cohesin proteins REC8, STAG3, SMC1 beta and SMC3 are consistent with a role in sister chromatid cohesion during meiosis in human oocytes. Hum Reprod. 2010 Jul 15 [PMID: 20634189]
Nozawa RS, Nagao K, Masuda HT et al. Human POGZ modulates dissociation of HP1alpha from mitotic chromosome arms through Aurora B activation. Nat Cell Biol 12(7):719-27. 2010 Jul. [PMID: 20562864]
Show All 17 Publications.

Reviews for Shugoshin Antibody (H00151648-M01) (0)

There are no reviews for Shugoshin Antibody (H00151648-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Shugoshin Antibody (H00151648-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Shugoshin Products

Bioinformatics Tool for Shugoshin Antibody (H00151648-M01)

Discover related pathways, diseases and genes to Shugoshin Antibody (H00151648-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Shugoshin Antibody (H00151648-M01)

Discover more about diseases related to Shugoshin Antibody (H00151648-M01).
 

Pathways for Shugoshin Antibody (H00151648-M01)

View related products by pathway.

PTMs for Shugoshin Antibody (H00151648-M01)

Learn more about PTMs related to Shugoshin Antibody (H00151648-M01).
 

Research Areas for Shugoshin Antibody (H00151648-M01)

Find related products by research area.

Blogs on Shugoshin

There are no specific blogs for Shugoshin, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Shugoshin Antibody (3C11) and receive a gift card or discount.

Bioinformatics

Gene Symbol SGO1
Entrez
OMIM
Uniprot