PPP2R4 Antibody

Western Blot: PPP2R4 Antibody [NBP1-87232] - Analysis in human cell line SiHa.

Immunocytochemistry/Immunofluorescence: PPP2R4 Antibody [NBP1-87232] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: PPP2R4 Antibody [NBP1-87232] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.

Western Blot: PPP2R4 Antibody [NBP1-87232] - Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Western Blot: PPP2R4 Antibody [NBP1-87232] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Immunohistochemistry-Paraffin: PPP2R4 Antibody [NBP1-87232] - Staining of human cerebral cortex shows moderate cytoplasmic and nuclear positivity in neuronal cells.

Immunohistochemistry-Paraffin: PPP2R4 Antibody [NBP1-87232] - Staining of human kidney shows moderate cytoplasmic and nuclear positivity in cells in tubules.

Immunohistochemistry-Paraffin: PPP2R4 Antibody [NBP1-87232] - Staining of human testis shows strong cytoplasmic and nuclear positivity in cells in seminiferous ducts and leydig cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

PPP2R4 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KLQKTYRMEPAGSQGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECILFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHFKF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PPP2R4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
  • Western Blot 1:100-1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PPP2R4 Protein (NBP1-87232PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PPP2R4 Antibody

• EC 5.2.1.8
• MGC2184
• Phosphotyrosyl phosphatase activator
• PP2A phosphatase activator
• PP2A subunit B' isoform PR53
• PP2A
• PP2A, subunit B', PR53 isoform
• PPP2R4
• protein phosphatase 2A activator, regulatory subunit 4
• PTPA
• regulatory subunit B' (PR 53)
• serine/threonine-protein phosphatase 2A activator
• Serine/threonine-protein phosphatase 2A regulatory subunit 4
• Serine/threonine-protein phosphatase 2A regulatory subunit B'

Background

Protein phosphatase 2A is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division. Protein phosphatase 2A holoenzymes are heterotrimeric proteins composed of a structural subunit A, a catalytic subunit C, and a regulatory subunit B. The regulatory subunit is encoded by a diverse set of genes that have been grouped into the B/PR55, B'/PR61, and B''/PR72 families. These different regulatory subunits confer distinct enzymatic specificities and intracellular localizations to the holozenzyme. The product of this gene belongs to the B' family. This gene encodes a specific phosphotyrosyl phosphatase activator of the dimeric form of protein phosphatase 2A. Alternative splicing results in multiple transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PPP2R4