PPP2R4 Antibody

Images

 
Western Blot: PPP2R4 Antibody [NBP1-87232] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: PPP2R4 Antibody [NBP1-87232] - Staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: PPP2R4 Antibody [NBP1-87232] - Staining of human kidney shows moderate cytoplasmic and nuclear positivity in cells in tubules.
Western Blot: PPP2R4 Antibody [NBP1-87232] - Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PPP2R4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KLQKTYRMEPAGSQGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECILFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHFKF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPP2R4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PPP2R4 Protein (NBP1-87232PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PPP2R4 Antibody

  • EC 5.2.1.8
  • MGC2184
  • Phosphotyrosyl phosphatase activator
  • PP2A phosphatase activator
  • PP2A subunit B' isoform PR53
  • PP2A
  • PP2A, subunit B', PR53 isoform
  • PPP2R4
  • protein phosphatase 2A activator, regulatory subunit 4
  • PTPA
  • regulatory subunit B' (PR 53)
  • serine/threonine-protein phosphatase 2A activator
  • Serine/threonine-protein phosphatase 2A regulatory subunit 4
  • Serine/threonine-protein phosphatase 2A regulatory subunit B'

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NLS1071
Species: Hu
Applications: IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-1793
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-31266
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PPP2R4 Antibody (NBP1-87232) (0)

There are no publications for PPP2R4 Antibody (NBP1-87232).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPP2R4 Antibody (NBP1-87232) (0)

There are no reviews for PPP2R4 Antibody (NBP1-87232). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PPP2R4 Antibody (NBP1-87232) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PPP2R4 Products

Bioinformatics Tool for PPP2R4 Antibody (NBP1-87232)

Discover related pathways, diseases and genes to PPP2R4 Antibody (NBP1-87232). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPP2R4 Antibody (NBP1-87232)

Discover more about diseases related to PPP2R4 Antibody (NBP1-87232).
 

Pathways for PPP2R4 Antibody (NBP1-87232)

View related products by pathway.

PTMs for PPP2R4 Antibody (NBP1-87232)

Learn more about PTMs related to PPP2R4 Antibody (NBP1-87232).
 

Research Areas for PPP2R4 Antibody (NBP1-87232)

Find related products by research area.

Blogs on PPP2R4

There are no specific blogs for PPP2R4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PPP2R4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP2R4
Entrez