GSG2 Antibody

Western Blot: GSG2 Antibody [NBP1-81774] - Analysis in human cell line Daudi.

Immunohistochemistry-Paraffin: GSG2 Antibody [NBP1-81774] - Staining of human hippocampus shows strong nuclear membranous positivity in neuronal cells.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

GSG2 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QVSIIDYTLSRLERDGIVVFCDVSMDEDLFTGDGDYQFDIYRLMKKENNNRWGEYHPYSNVLWLHYLTDKMLKQMTFKTKCNTPAMK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GSG2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  GSG2 Protein (NBP1-81774PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%), Rat (80%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GSG2 Antibody

• EC 2.7.11.1
• germ cell associated 2 (haspin)
• Germ cell-specific gene 2 protein
• Haploid germ cell-specific nuclear protein kinase
• haspin
• H-haspin
• serine/threonine-protein kinase haspin

Background

Hapsin is a serine-threonine protein kinase that was originally identified as a cDNA expressed specifically in mouse testicular germ cells. Haspin associates with the chromosomes, centrosomes, and spindle and is critical for proper chromosome alignment and segregation. Haspin is responsible for the phosphorylation of histone H3 at threonine 3.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GSG2