SHC3 Antibody

Images

 
Immunohistochemistry-Paraffin: SHC3 Antibody [NBP2-13307] Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SHC3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: HPYYNSIPSKMPPPGGFLDTRLKPRPHAPDTAQFAGKEQTYYQGRHLGDT FGEDWQQTPLRQGSSDIYSTPEGKLHVAPTGEAPTYVNTQQIPP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SHC3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SHC3 Protein (NBP2-13307PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%), Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SHC3 Antibody

  • Neuronal Shc
  • NSHCDKFZp686H1544
  • N-Shcsrc homology 2 domain containing transforming protein C3
  • Protein Rai
  • RAI
  • SH2 domain protein C3
  • SHC (Src homology 2 domain containing) transforming protein 3
  • SHCCFLJ45325
  • SHC-transforming protein 3
  • SHC-transforming protein C
  • src homology 2 domain-containing transforming protein C3
  • Src homology 2 domain-containing-transforming protein C3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006464-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, PLA
NBP1-87076
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP2-48732
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF482
Species: Mu
Applications: WB, IHC
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-25250
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
MAB38461
Species: Hu
Applications: WB, IHC
NB110-60490
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP2-13307
Species: Hu
Applications: IHC, IHC-P

Publications for SHC3 Antibody (NBP2-13307) (0)

There are no publications for SHC3 Antibody (NBP2-13307).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SHC3 Antibody (NBP2-13307) (0)

There are no reviews for SHC3 Antibody (NBP2-13307). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SHC3 Antibody (NBP2-13307) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SHC3 Products

Bioinformatics Tool for SHC3 Antibody (NBP2-13307)

Discover related pathways, diseases and genes to SHC3 Antibody (NBP2-13307). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SHC3 Antibody (NBP2-13307)

Discover more about diseases related to SHC3 Antibody (NBP2-13307).
 

Pathways for SHC3 Antibody (NBP2-13307)

View related products by pathway.

PTMs for SHC3 Antibody (NBP2-13307)

Learn more about PTMs related to SHC3 Antibody (NBP2-13307).

Blogs on SHC3

There are no specific blogs for SHC3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SHC3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SHC3