SHC3 Antibody - BSA Free

Immunohistochemistry-Paraffin: SHC3 Antibody [NBP2-13307] Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.

Staining of human cerebral cortex shows weak cytoplasmic positivity in neurons.

Staining of human fallopian tube shows moderate membranous and cytoplasmic positivity in glandular cells.

Staining of human cerebellum shows moderate cytoplasmic positivity in cells in molecular layer.

Staining of human rectum shows moderate membranous and cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SHC3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SHC3 Antibody - BSA Free (NBP2-13307) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: HPYYNSIPSKMPPPGGFLDTRLKPRPHAPDTAQFAGKEQTYYQGRHLGDTFGEDWQQTPLRQGSSDIYSTPEGKLHVAPTGEAPTYVNTQQIPP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SHC3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SHC3 Protein (NBP2-13307PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (81%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SHC3 Antibody - BSA Free

• Neuronal Shc
• NSHCDKFZp686H1544
• N-Shcsrc homology 2 domain containing transforming protein C3
• Protein Rai
• RAI
• SH2 domain protein C3
• SHC (Src homology 2 domain containing) transforming protein 3
• SHCCFLJ45325
• SHC-transforming protein 3
• SHC-transforming protein C
• src homology 2 domain-containing transforming protein C3
• Src homology 2 domain-containing-transforming protein C3

Background

Signaling adapter that couples activated growth factor receptors to signaling pathway in neurons. Involved in the signal transduction pathways of neurotrophin-activated Trk receptors in cortical neuron

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SHC3