SHC2 Antibody - BSA Free

Western Blot: SHC2 Antibody [NBP2-85723] - Host: Rabbit. Target Name: SHC2. Sample Tissue: Human HCT116 Whole Cell. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

SHC2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SHC2 Antibody - BSA Free (NBP2-85723) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SHC2. Peptide sequence: LRDACSLPWDVGSTGTAPPGDGYVQADARGPPDHEEHLYVNTQGLDAPEP The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SHC2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SHC2 Antibody - BSA Free

• neuronal Shc adaptor homolog
• Protein Sck
• SCKSH2 domain protein C2
• SHC (Src homology 2 domain containing) transforming protein 2
• SHCBSHC-transforming protein B
• SHC-transforming protein 2
• SLI
• Src homology 2 domain-containing-transforming protein C2

Background

Signaling adapter that couples activated growth factor receptors to signaling pathway in neurons. Involved in the signal transduction pathways of neurotrophin-activated Trk receptors in cortical neurons

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SHC2