ROBO2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ROBO2 Antibody [NBP1-81399] - Staining of human cell line SH-SY5Y shows localization to nucleus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ROBO2 Antibody [NBP1-81399] - Staining of mouse embryo E14 shows strong positivity in developing olfactory bulb and olfactory nerve.
Immunohistochemistry-Paraffin: ROBO2 Antibody [NBP1-81399] - Staining of human cerebral cortex shows moderate positivity in neuronal processes in neuropil.
Immunohistochemistry-Paraffin: ROBO2 Antibody [NBP1-81399] - Staining of human kidney shows negative to very weak cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: ROBO2 Antibody [NBP1-81399] - Staining of human liver shows very weak cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: ROBO2 Antibody [NBP1-81399] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity Hu, Mu, Rt, PmSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KO
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ROBO2 Antibody Summary

Immunogen
This antibody was developed against Recombinant ROBO2 Protein corresponding to amino acids: PVNNSNSGPNEIGNFGRGDVLPPVPGQGDKTATMLSDGAIYSSIDFTTKTSYNSSSQITQATPYATTQILHSNSIHELAVDLPDPQWKSSIQQKTDLMGFGYSLPDQNKGNNGGKGGKKKKNKNSSKPQKNNGSTWA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ROBO2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockout Validated
  • Western Blot 0.04-0.4 ug/ml
Application Notes
IHC reported in scientific literature (PMID: 24597571). WB reported in scientific literature (PMID: 32220420). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Knockout validation (PMID: 32220420).
Control Peptide
ROBO2 Protein (NBP1-81399PEP)
Publications
Read Publications using
NBP1-81399 in the following applications:

  • 2 publications
  • IHC
    1 publication
  • KO
    1 publication
  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24597571). Mouse, rat and monkey reported in scientific literature (PMID: 32220420).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ROBO2 Antibody

  • Drosophila) homolog 2
  • ROBO2
  • roundabout, axon guidance receptor, homolog 2 (Drosophila)
  • SAX3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB3629
Species: Mu
Applications: IHC
5444-SL
Species: Mu
Applications: BA
6514-SL
Species: Hu
Applications: BA
AF1749
Species: Rt
Applications: IHC, WB
AF3076
Species: Hu
Applications: IHC, WB
NBP1-87076
Species: Hu
Applications: IHC, IHC-P, WB
1109-N1/CF
Species: Mu
Applications: Bind
AF844
Species: Mu
Applications: Block, WB
NBP2-27419
Species: Hu, Pm
Applications: IHC, IHC-P, WB
NB110-58780
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
DVE00
Species: Hu
Applications: ELISA
AF1166
Species: Mu
Applications: WB
212-GD/CF
Species: Hu
Applications: Bind, BA
DLP00
Species: Hu
Applications: ELISA
MAB1790
Species: Hu
Applications: IHC, Simple Western, WB
NBP2-43853
Species: Bv, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
AF566
Species: Mu, Rt
Applications: Block, CyTOF-ready, Flow, IHC, WB
NBP1-88830
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
1250-S3
Species: Hu
Applications: BA, BA
NBP1-81399
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P, KO

Publications for ROBO2 Antibody (NBP1-81399)(3)

Reviews for ROBO2 Antibody (NBP1-81399) (0)

There are no reviews for ROBO2 Antibody (NBP1-81399). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ROBO2 Antibody (NBP1-81399) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ROBO2 Products

Bioinformatics Tool for ROBO2 Antibody (NBP1-81399)

Discover related pathways, diseases and genes to ROBO2 Antibody (NBP1-81399). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ROBO2 Antibody (NBP1-81399)

Discover more about diseases related to ROBO2 Antibody (NBP1-81399).
 

Pathways for ROBO2 Antibody (NBP1-81399)

View related products by pathway.

PTMs for ROBO2 Antibody (NBP1-81399)

Learn more about PTMs related to ROBO2 Antibody (NBP1-81399).

Blogs on ROBO2

There are no specific blogs for ROBO2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ROBO2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ROBO2