ROBO2 Antibody

Immunocytochemistry/Immunofluorescence: ROBO2 Antibody [NBP1-81399] - Staining of human cell line SH-SY5Y shows localization to nucleus. Antibody staining is shown in green.

Immunohistochemistry: ROBO2 Antibody [NBP1-81399] - Anti-ROBO1 and anti-ROBO2 (NBP1-81399) staining in the corresponding KO embryos, showing the specificity of the antibodies. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31392959/) licensed under a CC-BY license.

Immunohistochemistry-Paraffin: ROBO2 Antibody [NBP1-81399] - Staining of human cerebral cortex shows moderate positivity in neuronal processes in neuropil.

Immunohistochemistry-Paraffin: ROBO2 Antibody [NBP1-81399] - Staining of human kidney shows negative to very weak cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: ROBO2 Antibody [NBP1-81399] - Staining of human liver shows very weak cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: ROBO2 Antibody [NBP1-81399] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: ROBO2 Antibody [NBP1-81399] - Staining of mouse embryo E14 shows strong positivity in developing olfactory bulb and olfactory nerve.

• Reactivity: Hu, Mu, Rt, Pm
• Applications: WB, ICC/IF, IHC, KO
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

ROBO2 Antibody Summary

• Immunogen: This antibody was developed against Recombinant ROBO2 Protein corresponding to amino acids: PVNNSNSGPNEIGNFGRGDVLPPVPGQGDKTATMLSDGAIYSSIDFTTKTSYNSSSQITQATPYATTQILHSNSIHELAVDLPDPQWKSSIQQKTDLMGFGYSLPDQNKGNNGGKGGKKKKNKNSSKPQKNNGSTWA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ROBO2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockout Validated Reported in scientific literature (PMID: 32220420).
  • Western Blot Reported in scientific literature (PMID: 32220420).
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ROBO2 Protein (NBP1-81399PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24597571). Mouse, rat and monkey reported in scientific literature (PMID: 32220420).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ROBO2 Antibody

• Drosophila) homolog 2
• ROBO2
• roundabout, axon guidance receptor, homolog 2 (Drosophila)
• SAX3

Background

Robo2 belongs to the ROBO family, part of the immunoglobulin superfamily proteins that are highly conserved from fly to human. The encoded protein is a receptor for SLIT2, molecules known to function in axon guidance and cell migration. Defects in this gene are the cause of vesicoureteral reflux type 2. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ROBO2 Antibody (NBP1-81399)(4)

Publications using NBP1-81399

• Jabbari K, Cheng Q, Winkelmaier G Et al. CD36(+) Fibroblasts Secrete Protein Ligands That Growth-Suppress Triple-Negative Breast Cancer Cells While Elevating Adipogenic Markers for a Model of Cancer-Associated Fibroblast Int J Mol Sci 2022-11-11 [PMID: 36361532] (ICC/IF, Human)
  
  Details:
  Citation using the FITC version of this antibody.
• O'Donnell Jc, Purvis Em, Helm Kvt Et Al. An implantable human stem cell-derived tissue-engineered rostral migratory stream for directed neuronal replacement Communications biology 2021-07-15 [PMID: 34267315] (ICC/IF)
• Pisarek-Horowitz A, Fan X, Kumar S et Al. Loss of Roundabout Guidance Receptor 2 (Robo2) in Podocytes Protects Adult Mice from Glomerular Injury by Maintaining Podocyte Foot Process Structure Am. J. Pathol. 2020-03-20 [PMID: 32220420] (WB, ICC/IF, KO, Human, Rat, Mouse, Monkey)
• Sanz-Pamplona R, Berenguer A, Cordero D et al. Aberrant gene expression in mucosa adjacent to tumor reveals a molecular crosstalk in colon cancer. Mol Cancer 2014-03-05 [PMID: 24597571] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: ROBO2