SHB Antibody - Azide and BSA Free

Western Blot: SHB Antibody [NBP2-94662] - Analysis of extracts of various cell lines, using SHB at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 90s.

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SHB Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit SHB Antibody - Azide and BSA Free (NBP2-94662) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 300-400 of human SHB (NP_003019.2). PYEPEGQSVDSDSESTVSPRLRESKLPQDDDRPADEYDQPWEWNRVTIPALAAQFNGNEKRQSSPSPSRDRRRQLRAPGGGFKPIKHGSPEFCGILGERVD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SHB
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:200-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for SHB Antibody - Azide and BSA Free

• bA3J10.2
• RP11-3J10.8
• SH2 domain-containing adapter protein B
• SHB (Src homology 2 domain containing) adaptor protein B
• SHB adaptor protein (a Src homology 2 protein)
• SHB
• Src homology 2 domain containing adaptor protein B

Background

SHB is an adapter protein which regulates several signal transduction cascades by linking activated receptors to downstream signaling components. It may play a role in angiogenesis by regulating FGFR1, VEGFR2 and PDGFR signaling. It may also play a role in T-cell antigen receptor/TCR signaling, interleukin-2 signaling, apoptosis and neuronal cells differentiation by mediating basic-FGF and NGF-induced signaling cascades, and may also regulate IRS1 and IRS2 signaling in insulin-producing cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: SHB