SHB Antibody

Images

 
Immunohistochemistry: SHB Antibody [NBP2-30557] - Staining of human small intestine shows moderate cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SHB Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: TACGGKKLLNKCAASAAEESGAGKKDKVTIADDYSDPFDAKNDLKSKAGKGESAGYM
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SHB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SHB Protein (NBP2-30557PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SHB Antibody

  • bA3J10.2
  • RP11-3J10.8
  • SH2 domain-containing adapter protein B
  • SHB (Src homology 2 domain containing) adaptor protein B
  • SHB adaptor protein (a Src homology 2 protein)
  • SHB
  • Src homology 2 domain containing adaptor protein B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-47761
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-1287
Species: Hu, Mu, Rt
Applications: WB, Flow, IP, CyTOF-ready
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-27104
Species: Hu, Mu, Pm
Applications: WB, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
AF3978
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
MAB37861
Species: Hu
Applications: WB, Simple Western, ICC

Publications for SHB Antibody (NBP2-30557) (0)

There are no publications for SHB Antibody (NBP2-30557).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SHB Antibody (NBP2-30557) (0)

There are no reviews for SHB Antibody (NBP2-30557). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SHB Antibody (NBP2-30557) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SHB Products

Bioinformatics Tool for SHB Antibody (NBP2-30557)

Discover related pathways, diseases and genes to SHB Antibody (NBP2-30557). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SHB Antibody (NBP2-30557)

Discover more about diseases related to SHB Antibody (NBP2-30557).
 

Pathways for SHB Antibody (NBP2-30557)

View related products by pathway.

PTMs for SHB Antibody (NBP2-30557)

Learn more about PTMs related to SHB Antibody (NBP2-30557).

Blogs on SHB

There are no specific blogs for SHB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SHB Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SHB
Entrez
Uniprot