SGLT2/SLC5A2 Antibody - Azide and BSA Free

Western Blot: SGLT2/SLC5A2 Antibody - Azide and BSA Free [SGLT2/SLC5A2] - Western blot analysis of various lysates, using SGLT2/SLC5A2 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit .Exposure time: 45s.

Immunohistochemistry-Paraffin: SGLT2/SLC5A2 Antibody [NBP3-15989] - Rat kidney using SLC5A2 Rabbit pAb at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: SGLT2/SLC5A2 Antibody [NBP3-15989] - Mouse kidney using SLC5A2 Rabbit pAb at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunocytochemistry/ Immunofluorescence: SGLT2/SLC5A2 Antibody - Azide and BSA Free [SGLT2/SLC5A2] - Immunofluorescence analysis of paraffin-embedded Rat kidney using SGLT2/SLC5A2 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: SGLT2/SLC5A2 Antibody - Azide and BSA Free [SGLT2/SLC5A2] - Immunofluorescence analysis of paraffin-embedded Human kidney using SGLT2/SLC5A2 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: SGLT2/SLC5A2 Antibody - Azide and BSA Free [SGLT2/SLC5A2] - Immunofluorescence analysis of paraffin-embedded rat kidney using SGLT2/SLC5A2 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SGLT2/SLC5A2 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit SGLT2/SLC5A2 Antibody - Azide and BSA Free (NBP3-15989) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 564-624 of human SGLT2/SLC5A2 (NP_003032.1). RHSKEEREDLDADEQQGSSLPVQNGCPESAMEMNEPQAPAPSLFRQCLLWFCGMSRGGVGS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC5A2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 -1:200
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for SGLT2/SLC5A2 Antibody - Azide and BSA Free

• Low affinity sodium-glucose cotransporter
• Na(+)/glucose cotransporter 2
• SGLT2
• SGLT2sodium/glucose cotransporter 2
• SLC5A2
• solute carrier family 5 (sodium/glucose cotransporter), member 2
• solute carrier family 5 (sodium/glucose transporter), member 2
• Solute carrier family 5 member 2

Background

The SGLT2 gene encodes a member of the sodium glucose cotransporter family which are sodium-dependent glucose transport proteins. The encoded protein is the major cotransporter involved in glucose reabsorption in the kidney. Mutations in this gene are associat

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: SLC5A2