SGLT2/SLC5A2 Antibody

Images

 
Immunohistochemistry-Paraffin: SGLT2/SLC5A2 Antibody [NBP1-92384] - Staining of human kidney shows moderate positivity in apical membrane in cells in tubules.
Orthogonal Strategies: Immunohistochemistry-Paraffin: SGLT2/SLC5A2 Antibody [NBP1-92384] - Analysis in human kidney and endometrium tissues. Corresponding SLC5A2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SGLT2/SLC5A2 Antibody [NBP1-92384] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemistry-Paraffin: SGLT2/SLC5A2 Antibody [NBP1-92384] - Staining of human endometrium shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: SGLT2/SLC5A2 Antibody [NBP1-92384] - Staining of human lymph node shows no positivity in non-germinal center cells as expected.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

SGLT2/SLC5A2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FHEVGGYSGLFDKYLGAATSLTVSEDPAVGNISSFCYRPRPDSYHLL
Specificity
Specificity of human SGLT2/SLC5A2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC5A2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, WB reactivity reported in scientific literature (PMID: 25894829).
Control
SGLT2/SLC5A2 Knockout HeLa Cell Lysate
Control Peptide
SGLT2/SLC5A2 Recombinant Protein Antigen (NBP1-92384PEP)
Publications
Read Publications using
NBP1-92384 in the following applications:

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SGLT2/SLC5A2 Antibody

  • Low affinity sodium-glucose cotransporter
  • Na(+)/glucose cotransporter 2
  • SGLT2
  • SGLT2sodium/glucose cotransporter 2
  • SLC5A2
  • solute carrier family 5 (sodium/glucose cotransporter), member 2
  • solute carrier family 5 (sodium/glucose transporter), member 2
  • Solute carrier family 5 member 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20338
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-39113
Species: Hu, Mu, Rt, Rb
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, Flow-IC
NBP2-22218
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82862
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-38323
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00000265-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP1-33596
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, PAGE
NBP1-62481
Species: Hu
Applications: WB
7270-IL/CF
Species: Hu
NBP1-92005
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89680
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, ChIP
NBP1-49533
Species: Hu, Mu, Rt, Pl
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC, KD
NBP1-33144
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
NBP1-76847
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-92384
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SGLT2/SLC5A2 Antibody (NBP1-92384)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(1)
WB
(1)
All Applications
Filter By Species
Human
(2)
All Species

Reviews for SGLT2/SLC5A2 Antibody (NBP1-92384) (0)

There are no reviews for SGLT2/SLC5A2 Antibody (NBP1-92384). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SGLT2/SLC5A2 Antibody (NBP1-92384) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SGLT2/SLC5A2 Products

Bioinformatics Tool for SGLT2/SLC5A2 Antibody (NBP1-92384)

Discover related pathways, diseases and genes to SGLT2/SLC5A2 Antibody (NBP1-92384). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SGLT2/SLC5A2 Antibody (NBP1-92384)

Discover more about diseases related to SGLT2/SLC5A2 Antibody (NBP1-92384).
 

Pathways for SGLT2/SLC5A2 Antibody (NBP1-92384)

View related products by pathway.

PTMs for SGLT2/SLC5A2 Antibody (NBP1-92384)

Learn more about PTMs related to SGLT2/SLC5A2 Antibody (NBP1-92384).
 

Research Areas for SGLT2/SLC5A2 Antibody (NBP1-92384)

Find related products by research area.

Blogs on SGLT2/SLC5A2

There are no specific blogs for SGLT2/SLC5A2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SGLT2/SLC5A2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC5A2