SGLT2/SLC5A2 Antibody - BSA Free

Immunohistochemistry-Paraffin: SGLT2/SLC5A2 Antibody [NBP1-92384] - SGLT2/SLC5A2 used at 1:50 on a tenrec kidney. SGLT2/SLC5A2 antibody was used on paraffin-embedded kidney tissue at a concentration of 20ug/mL and left at 4C overnight. HIER was performed in Citrate buffer (pH6) for two hours at 75C. Image from verified customer review.

Immunohistochemistry-Paraffin: SGLT2/SLC5A2 Antibody [NBP1-92384] - Staining of human lymph node shows no positivity in non-germinal center cells as expected.

Immunohistochemistry-Paraffin: SGLT2/SLC5A2 Antibody [NBP1-92384] - Staining of human kidney shows moderate positivity in apical membrane in cells in tubules.

Immunohistochemistry-Paraffin: SGLT2/SLC5A2 Antibody [NBP1-92384] - Analysis of SGLT2/SLC5A2 antibody on Canine kidney tissue. HIER was done in pH 6 (Citrate Buffer) for two hours at 75C, and primary antibody was put on at 1:100 overnight at 4C. Image was taken at 40X. Image from verified customer review.

Staining of human endometrium shows no positivity in glandular cells as expected.

Analysis in human kidney and endometrium tissues using NBP1-92384 antibody. Corresponding SLC5A2 RNA-seq data are presented for the same tissues.

Staining of human cerebral cortex shows no positivity in neurons as expected.

• Reactivity: Hu, Mu, Ca, Tn, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SGLT2/SLC5A2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SGLT2/SLC5A2 Antibody - BSA Free (NBP1-92384) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-SGLT2/SLC5A2 Antibody: Cited in 13 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FHEVGGYSGLFDKYLGAATSLTVSEDPAVGNISSFCYRPRPDSYHLL
• Predicted Species: Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC5A2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence Reactivity reported in scientific literature (PMID: 25894829).
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot Reactivity reported in scientific literature (PMID: 25894829).
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SGLT2/SLC5A2 Recombinant Protein Antigen (NBP1-92384PEP)

Reactivity Notes

Use in Mouse reported in scientific literature (PMID:33712686). Canine reactivity reported from a verified customer review. Tenrec reactivity reported from a verified customer review.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SGLT2/SLC5A2 Antibody - BSA Free

• Low affinity sodium-glucose cotransporter
• Na(+)/glucose cotransporter 2
• SGLT2
• SGLT2sodium/glucose cotransporter 2
• SLC5A2
• solute carrier family 5 (sodium/glucose cotransporter), member 2
• solute carrier family 5 (sodium/glucose transporter), member 2
• Solute carrier family 5 member 2

Background

The SGLT2 gene encodes a member of the sodium glucose cotransporter family which are sodium-dependent glucose transport proteins. The encoded protein is the major cotransporter involved in glucose reabsorption in the kidney. Mutations in this gene are associat

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SGLT2/SLC5A2 Antibody (NBP1-92384)(13)

Publications using NBP1-92384

• Suh HN, Lee JY, Kang HJ et Al. A Comparison Between GalT(-/-);hCD39;hCD55 and GalT(-/-);hCD39;hCD46;hCD55;TBM Pig Kidneys Transplanted in Nonhuman Primates Cell Transplant 2024-01-16 [PMID: 38229498]
• Shim B, Stokum JA, Moyer M et al. Canagliflozin, an Inhibitor of the Na(+)-Coupled D-Glucose Cotransporter, SGLT2, Inhibits Astrocyte Swelling and Brain Swelling in Cerebral Ischemia Cells 2023-09-06 [PMID: 37759444] (Western Blot, Immunocytochemistry/ Immunofluorescence, Human)
• Yu H, Wang M, Yu J et al. Evaluation of the efficacy of Abelmoschus manihot (L.) on diabetic nephropathy by analyzing biomarkers in the glomeruli and proximal and distal convoluted tubules of the kidneys Frontiers in Pharmacology 2023-08-01 [PMID: 37587982] (Western Blot, Immunocytochemistry/ Immunofluorescence, Human)
• Herat LY, Matthews JR, Hibbs M et al. SGLT1/2 inhibition improves glycemic control and multi-organ protection in type 1 diabetes iScience 2023-08-18 [PMID: 37520739] (Western Blot, Immunocytochemistry/ Immunofluorescence, Human)
• Schwertheim S, Alhardan M, Manka PP et al. Higher pNRF2, SOCS3, IRF3, and RIG1 Tissue Protein Expression in NASH Patients versus NAFL Patients: pNRF2 Expression Is Concomitantly Associated with Elevated Fasting Glucose Levels Journal of Personalized Medicine 2023-07-18 [PMID: 37511764] (Western Blot, Immunocytochemistry/ Immunofluorescence, Human)
• Berghaus C, Groh AC, Breljak D et al. Impact of Pals1 on Expression and Localization of Transporters Belonging to the Solute Carrier Family Frontiers in Molecular Biosciences 2022-02-16 [PMID: 35252349] (Western Blot, Immunocytochemistry/ Immunofluorescence, Human)
• Du J, Gu J, Deng J et al. The expression and survival significance of sodium glucose transporters in pancreatic cancer BMC cancer 2022-01-28 [PMID: 35090421] (IHC-P, Human)
• Mitsuhata Y, Abe T, Misaki K et al. Cyst formation in proximal renal tubules caused by dysfunction of the microtubule minus-end regulator CAMSAP3 Scientific reports 2021-03-12 [PMID: 33712686] (Mouse)
• Chiba Y, Murakami R, Matsumoto K et al. Glucose, Fructose, and Urate Transporters in the Choroid Plexus Epithelium International Journal of Molecular Sciences 2020-09-30 [PMID: 33008107] (IF/IHC, Human)
• Chiba Y, Sugiyama Y, Nishi N et al. Sodium/glucose cotransporter 2 is expressed in choroid plexus epithelial cells and ependymal cells in human and mouse brains Neuropathology 2020-10-01 [PMID: 32488949] (IHC-P, Human)
• Dai C, Walker J. T, et al. Dapagliflozin Does Not Directly Affect Human alpha or beta Cells. Endocrinology 2020-08-01 [PMID: 32428240] (IF/IHC, Mouse)
• Scafoglio CR, Villegas B, Abdelhady G et al. Sodium-glucose transporter 2 is a diagnostic and therapeutic target for early-stage lung adenocarcinoma. Sci Transl Med. 2018-11-14 [PMID: 30429355] (IHC-P, Human)
• Bonner C, Kerr-Conte J, Gmyr V et al. Inhibition of the glucose transporter SGLT2 with dapagliflozin in pancreatic alpha cells triggers glucagon secretion Nat. Med. 2015 Apr 20 [PMID: 25894829] (WB, ICC/IF, Human)

Reviews for SGLT2/SLC5A2 Antibody (NBP1-92384) (2)

Average Rating: 4.5

(Based on 2 reviews)

We have 2 reviews tested in 2 species: Canine, Tenrec.

reviewed by: Vojtech Gabriel IHC-P Tenrec 05/11/2022

Summary

• Application: Immunohistochemistry-Paraffin
• Sample Tested: IHC Sample Tested
• Species: Tenrec
• Lot: 000023192

reviewed by: Verified Customer IHC-P Canine 03/23/2022

Summary

• Application: Immunohistochemistry-Paraffin
• Sample Tested: Kidney tissue
• Species: Canine
• Lot: 000023192

Comments

• Comments: Canine Kidney. HIER was done in pH 6 (Citrate Buffer) for two hours at 75C, and primary antibody was put on at 1:100 overnight at 4C. Image was taken at 40X.

Bioinformatics

• Gene Symbol: SLC5A2