PSPC1 Antibody

Images

 
Western Blot: PSPC1 Antibody [NBP1-83801] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: PSPC1 Antibody [NBP1-83801] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: PSPC1 Antibody [NBP1-83801] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.
Western Blot: PSPC1 Antibody [NBP1-83801] - Analysis in human cell line HepG2.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PSPC1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PAMGPEGAANMGTPMMPDNGAVHNDRFPQGPPSQMGSPMGSRTGSETPQAPMSGVGPVSGGPGGFGRGSQGGNFEGPNKRRRY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PSPC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PSPC1 Recombinant Protein Antigen (NBP1-83801PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PSPC1 Antibody

  • FLJ33554
  • paraspeckle component 1
  • paraspeckle protein 1
  • PSP1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02060
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-61045
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-74360
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF1334
Species: Hu
Applications: WB, IHC
NB200-191
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-87381
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4094
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-31164
Species: Hu
Applications: WB, ICC/IF
NBP2-22169
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-84416
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-82452
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF4937
Species: Hu
Applications: WB, IHC
AF5659
Species: Hu
Applications: WB
NBP1-56848
Species: Hu
Applications: WB
NBP2-02450
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-07321
Species: Hu
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for PSPC1 Antibody (NBP1-83801) (0)

There are no publications for PSPC1 Antibody (NBP1-83801).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PSPC1 Antibody (NBP1-83801) (0)

There are no reviews for PSPC1 Antibody (NBP1-83801). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PSPC1 Antibody (NBP1-83801) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PSPC1 Products

Bioinformatics Tool for PSPC1 Antibody (NBP1-83801)

Discover related pathways, diseases and genes to PSPC1 Antibody (NBP1-83801). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PSPC1 Antibody (NBP1-83801)

Discover more about diseases related to PSPC1 Antibody (NBP1-83801).
 

Pathways for PSPC1 Antibody (NBP1-83801)

View related products by pathway.

Blogs on PSPC1

There are no specific blogs for PSPC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PSPC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PSPC1