PSPC1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: PSPC1 Antibody [NBP1-83801] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining shown in green.

Immunohistochemistry-Frozen: PSPC1 Antibody [NBP1-83801] - Rat brain tissue. Fresh frozen 16 um. PSPC1 (1:500, green), DAPI (blue). IHC-Fr image submitted by a verified customer review.

Immunohistochemistry-Paraffin: PSPC1 Antibody [NBP1-83801] - Staining of human cerebellum shows nuclear positivity.

Immunohistochemistry-Paraffin: PSPC1 Antibody [NBP1-83801] - Staining of human kidney shows nuclear positivity in cells in tubules.

Immunohistochemistry-Paraffin: PSPC1 Antibody [NBP1-83801] - Staining of human skeletal muscle shows nuclear positivity in myocytes.

Immunohistochemistry-Paraffin: PSPC1 Antibody [NBP1-83801] - Staining of human testis shows nuclear positivity in cells in seminiferous ducts.

Analysis in human cell lines Caco-2 and HeLa using Anti-PSPC1 antibody. Corresponding PSPC1 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PSPC1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PSPC1 Antibody - BSA Free (NBP1-83801) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-PSPC1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PAMGPEGAANMGTPMMPDNGAVHNDRFPQGPPSQMGSPMGSRTGSETPQAPMSGVGPVSGGPGGFGRGSQGGNFEGPNKRRRY
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PSPC1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25 - 2 ug/mL
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Frozen Validated from a verified customer review
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04 - 0.4 ug/mL
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PSPC1 Recombinant Protein Antigen (NBP1-83801PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2), 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PSPC1 Antibody - BSA Free

• FLJ33554
• paraspeckle component 1
• paraspeckle protein 1
• PSP1

Background

Regulates, cooperatively with NONO and SFPQ, androgen receptor-mediated gene transcription activity in Sertoli cell line . Binds to poly(A), poly(G) and poly(U) RNA homopolymers

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PSPC1 Antibody (NBP1-83801)(1)

Publication using NBP1-83801

• Soledad Bárez-López, Agnieszka Konopacka, Stephen J Cross, Mingkwan Greenwood, Marina Skarveli, David Murphy, Michael P Greenwood Transcriptional and Post-Transcriptional Regulation of Oxytocin and Vasopressin Gene Expression by CREB3L1 and CAPRIN2. Neuroendocrinology 2022-10-26 [PMID: 35051932]

Review for PSPC1 Antibody (NBP1-83801) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Rat.

reviewed by: Soledad Barez IHC-Fr Rat 02/09/2021

Summary

• Application: Immunohistochemistry-Frozen
• Sample Tested: brain fresh frozen
• Species: Rat
• Lot: D117724

Comments

• Comments: ***Bio-Techne Response: This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.***

Bioinformatics

• Gene Symbol: PSPC1