SF3B5 Antibody

Images

 
Western Blot: SF3B5 Antibody [NBP2-13301] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: SF3B5 Antibody [NBP2-13301] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: SF3B5 Antibody [NBP2-13301] - Staining of human bone marrow shows moderate nuclear positivity in hematopoietic cells.
Immunohistochemistry-Paraffin: SF3B5 Antibody [NBP2-13301] - Staining of human rectum shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SF3B5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNY FAIAENESKARVRFNLMEKMLQPCGPPADKPEEN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SF3B5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SF3B5 Protein (NBP2-13301PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SF3B5 Antibody

  • MGC3133
  • Pre-mRNA-splicing factor SF3b 10 kDa subunit
  • SF3b10
  • SF3b5
  • splicing factor 3B subunit 5
  • splicing factor 3b, subunit 5, 10kDa
  • Ysf3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92692
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NB100-79848
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-91776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13785
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-53181
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-20403
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-1713
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB100-55256
Species: Hu
Applications: WB, IHC-P, IP
NBP2-13920
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1077
Species: Hu
Applications: WB, PEP-ELISA
NBP1-81801
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85269
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88591
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-79843
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, ChIP
NBP2-49381
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-71687
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-84010
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00008175-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP

Publications for SF3B5 Antibody (NBP2-13301) (0)

There are no publications for SF3B5 Antibody (NBP2-13301).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SF3B5 Antibody (NBP2-13301) (0)

There are no reviews for SF3B5 Antibody (NBP2-13301). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SF3B5 Antibody (NBP2-13301) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SF3B5 Products

Bioinformatics Tool for SF3B5 Antibody (NBP2-13301)

Discover related pathways, diseases and genes to SF3B5 Antibody (NBP2-13301). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SF3B5

There are no specific blogs for SF3B5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SF3B5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SF3B5