BUD31 Antibody

Images

 
Western Blot: BUD31 Antibody [NBP1-84010] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: BUD31 Antibody [NBP1-84010] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & microtubules.
Immunohistochemistry-Paraffin: BUD31 Antibody [NBP1-84010] - Staining of human nasopharynx shows strong cytoplasmic and nuclear positivity in respiratory epithelial cells.
Western Blot: BUD31 Antibody [NBP1-84010] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BUD31 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFRIHHQKTRYIFDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICRVPKSKLEVGRIIE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BUD31
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
BUD31 Protein (NBP1-84010PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BUD31 Antibody

  • BUD31 homolog (S. cerevisiae)
  • BUD31 homolog (yeast)
  • EDG-2
  • EDG2MGC111202
  • fSAP17
  • functional spliceosome-associated protein 17
  • G10 maternal transcript homolog
  • G10
  • maternal G10 transcript
  • protein BUD31 homolog
  • Protein EDG-2
  • Protein G10 homolog
  • YCR063W

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NLS1014
Species: Hu, Mu, Rt, Bt, Bv, Ca, Eq, Ha, Mk, Pm
Applications: IHC-P
NBP1-84903
Species: Hu
Applications: WB, IHC, IHC-P
H00001192-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-03363
Species: Hu, Rt, Ch
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
30230002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
MAB7089
Species: Mu
Applications: Flow, IHC, CyTOF-ready
H00008720-M07
Species: Hu
Applications: ELISA, ICC/IF
NBP2-26691
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP2-24762
Species: Hu, Mu
Applications: WB, IHC-P
NBP2-33955
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89810
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91687
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-57274
Species: Hu
Applications: WB, ICC/IF

Publications for BUD31 Antibody (NBP1-84010) (0)

There are no publications for BUD31 Antibody (NBP1-84010).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BUD31 Antibody (NBP1-84010) (0)

There are no reviews for BUD31 Antibody (NBP1-84010). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for BUD31 Antibody (NBP1-84010) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BUD31 Products

Bioinformatics Tool for BUD31 Antibody (NBP1-84010)

Discover related pathways, diseases and genes to BUD31 Antibody (NBP1-84010). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for BUD31 Antibody (NBP1-84010)

View related products by pathway.

Blogs on BUD31

There are no specific blogs for BUD31, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BUD31 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BUD31