Home » GPKOW » GPKOW Antibodies » GPKOW Antibody

GPKOW Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Knockdown Validated: GPKOW Antibody [NBP1-81800] - Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-GPKOW antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Genetic Strategies: Knockdown Validated: GPKOW Antibody [NBP1-81800] - Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-GPKOW antibody. Remaining relative ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: GPKOW Antibody [NBP1-81800] - Staining of human cerebral cortex, colon, kidney and pancreas using Anti-GPKOW antibody NBP1-81800 (A) shows similar protein ...read more
Independent Antibodies: Western Blot: GPKOW Antibody [NBP1-81800] - Analysis using Anti-GPKOW antibody NBP1-81800 (A) shows similar pattern to independent antibody NBP1-81801 (B).
Immunocytochemistry/ Immunofluorescence: GPKOW Antibody [NBP1-81800] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: GPKOW Antibody [NBP1-81800] - Staining of human kidney.
Western Blot: GPKOW Antibody [NBP1-81800] - Analysis in human cell line A-549.
Immunohistochemistry-Paraffin: GPKOW Antibody [NBP1-81800] - Staining of human fallopian tube shows nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: GPKOW Antibody [NBP1-81800] - Staining of human pancreas.
Immunohistochemistry-Paraffin: GPKOW Antibody [NBP1-81800] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: GPKOW Antibody [NBP1-81800] - Staining of human colon.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

    

Genetic Strategies

    

Order Details

100% Guarantee on every product

GPKOW Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MPRPDEEQEKDKEDQPQGLVPGGAVVVLSGPHRGLYGKVEGLDPDNVRAMVRLAVGSRVVTVSEYYLRPVSQQEFDKNTLDLRQQNGTASSRKTLWNQELYIQQDNSERKRKHLPD
Marker
Nucleus Marker
Specificity
Specificity of human GPKOW antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GPKOW
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GPKOW Protein (NBP1-81800PEP)
Publications
Read Publication using NBP1-81800.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GPKOW Antibody

  • G patch domain and KOW motifs
  • GPATC5G patch domain and KOW motifs-containing protein
  • GPATCH5G patch domain-containing protein 5
  • Protein MOS2 homolog
  • Spp2
  • T54Protein T54

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Osteopontin/OPN
Antibody [Unconjugate
AF808
Recombinant Mouse Osteopontin/OPN (Catalog # 441-OP), immobilized onto a microplate, supports the adhesion of the HEK293 human embryonic kidney cell line in a dose-dependent manner (orange line). Adhesion elicited by Recombinant Mouse Osteopontin/OPN (2 µg/mL) is neutralized (green line) by increasing concentrations of Mouse Osteopontin/OPN Antigen Affinity-purified Polyclonal Antibody (Catalog # AF808). The ND50 is typically 1‑3 µg/mL.
Osteopontin/OPN was detected in perfusion fixed frozen sections of mouse thymus using Mouse Osteopontin/OPN Antigen Affinity-purified Polyclonal Antibody (Catalog # AF808) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(4 Reviews)
(56 Publications)
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Sphingosine 1
phosphate phosphatase ...
NBP1-53181
Western Blot: Sphingosine 1 phosphate phosphatase 2 Antibody [NBP1-53181] - Titration: 2.5ug/ml Positive Control: HepG2 cell lysate.
Immunohistochemistry-Paraffin: Sphingosine 1 phosphate phosphatase 2 Antibody [NBP1-53181] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.
Species: Hu
Applications: WB, IHC, IHC-P
CXXC1 Antibody
NB100-56630
Western Blot: CXXC1 Antibody [NB100-56630] - analysis at 1:1,000 dilution against 15 ug/lane of human spleen lysate. Immunoreactivity was determined using SuperSignal system (Pierce) and by exposing to the film for 15 minutes.
(1 Publication)
Species: Hu
Applications: WB
DHX16 Antibody
NBP2-13920
Immunocytochemistry/Immunofluorescence: DHX16 Antibody [NBP2-13920] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: DHX16 Antibody [NBP2-13920] - Staining in human testis and liver tissues using anti-DHX16 antibody. Corresponding DHX16 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: DHX16 Antibody [NBP2-13920] - Staining of human kidney shows strong nuclear positivity in renal tubules and glomeruli.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Chk2 [p Thr68]
Antibody [Unconjugate
AF1626
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line untreated (-) or treated (+) with 1 µM camptothecin (CPT) for 1 hour. PVDF membrane was probed with 0.5 µg/mL Rabbit Anti-Human Phospho‑Chk2 (T68) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1626) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band for Phospho-Chk2 (T68) was detected at approximately 64 kDa (as indicated). The phospho-specificity of this antibody was supported by decreased labeling following treatment with 600 U lambda -phosphatase ( lambda -PPase) for  60 minutes. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Phopsho-Chk2 (T68) was detected in immersion fixed HepG2 human hepatocellular carcinoma cell line treated with 1 µM camptothecin using Rabbit Anti-Human Phospho-Chk2 (T68) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1626) at 1 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rabbit IgG Secondary Antibody (red; Catalog # NL004) and counterstained with DAPI (blue). Specific staining was localized to nuclei in treated cells. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(6 Publications)
Species: Hu
Applications: WB, ICC
TMEM171 Antibody
NBP1-80876
Western Blot: TMEM171 Antibody [NBP1-80876] - Analysis in control (vector only transfected HEK293T lysate) and TMEM171 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: TMEM171 Antibody [NBP1-80876] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.
Species: Hu
Applications: WB, IHC, IHC-P
DHX38 Antibody
NBP1-85269
Western Blot: DHX38 Antibody [NBP1-85269] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/Immunofluorescence: DHX38 Antibody [NBP1-85269] - Staining of human cell line U-2 OS shows positivity in nucleus.
Immunohistochemistry-Paraffin: DHX38 Antibody [NBP1-85269] - Staining of human esophagus shows strong cytoplasmic and nuclear positivity in squamous epithelial cells.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
SLU7 Antibody
NBP2-20403
Western Blot: SLU7 Antibody [NBP2-20403] - Sample (30 ug of whole cell lysate) A: Non-transfected 293T lysates, B: hSLU7 transfected 293T lysates 7. 5% SDS PAGE gel, diluted at 1:10000.
Immunohistochemistry-Paraffin: SLU7 Antibody [NBP2-20403] - Immunohistochemical analysis of paraffin-embedded HBL435 xenograft, using antibody at 1:500 dilution.
Western Blot: SLU7 Antibody [NBP2-20403] - Sample (30 ug of whole cell lysate) A: A431 B: HeLa C: HepG2 7. 5% SDS PAGE gel, diluted at 1:1000.
Species: Hu, Mu
Applications: WB, IHC, IHC-P
CDC2/CDK1 Antibody
NBP1-85729
Western Blot: CDC2/CDK1 Antibody [NBP1-85729] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/Immunofluorescence: CDC2/CDK1 Antibody [NBP1-85729] - Staining of human cell line U-251 MG shows localization to nucleus & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CDC2/CDK1 Antibody [NBP1-85729] - Staining in human tonsil and pancreas tissues. Corresponding CDK1 RNA-seq data are presented for the same tissues.
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
DHX8 Antibody
NBP2-13923
Western Blot: DHX8 Antibody [NBP2-13923] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.
Immunocytochemistry/Immunofluorescence: DHX8 Antibody [NBP2-13923] - Staining of human cell line HEK 293 shows positivity in nucleus but not nucleoli.
Immunohistochemistry-Paraffin: DHX8 Antibody [NBP2-13923] - Staining of human cerebellum shows strong cytoplasmic and nucleolar positivity in Purkinje cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Chk1 Antibody
(2G1D5)
NB100-1768
Western Blot: Chk1 Antibody (2G1D5) [NB100-1768] - Analysis using Chk1 mouse mAb against HEK293T cells transfected with the pCMV6-ENTRY control (1) and pCMV6-ENTRY Chk1 cDNA (2).
Immunocytochemistry/Immunofluorescence: Chk1 Antibody (2G1D5) [NB100-1768] - Chk1 antibody was tested at 1:10 in HeLa cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red). Image objective 40X.
Immunohistochemistry-Paraffin: Chk1 Antibody (2G1D5) [NB100-1768] - Analysis of FFPE human lung using Chk1 antibody (clone 2G1D5) at 1:250 on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) using 10 mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 30 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Whole slide scanning and capturing of representative images was performed using Aperio AT2 (Leica Biosystems). Cytoplasmic and nuclear staining of Chk1 was observed as this is a ubiquitous cell checkpoint protein. Staining was performed by Histowiz.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
DNA Polymerase
delta, catalytic subu ...
NBP2-33466
Western Blot: DNA Polymerase delta, catalytic subunit Antibody [NBP2-33466] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/Immunofluorescence: DNA Polymerase delta, catalytic subunit Antibody [NBP2-33466] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: DNA Polymerase delta, catalytic subunit Antibody [NBP2-33466] - Staining of human lymph node shows strong nuclear positivity in germinal center cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
CDS1 Antibody
(2D10)
H00001040-M01
Western Blot: CDS1 Antibody (2D10) [H00001040-M01] - CDS1 monoclonal antibody (M01), clone 2D10. Analysis of CDS1 expression in human liver.
Immunocytochemistry/Immunofluorescence: CDS1 Antibody (2D10) [H00001040-M01] - Analysis of monoclonal antibody to CDS1 on HeLa cell. Antibody concentration 10 ug/ml.
ELISA: CDS1 Antibody (2D10) [H00001040-M01] - Detection limit for recombinant GST tagged CDS1 is 0.1 ng/ml as a capture antibody.
(1 Review)
(2 Publications)
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
SGPP1 Antibody
NBP2-13303
Western Blot: SGPP1 Antibody [NBP2-13303] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/Immunofluorescence: SGPP1 Antibody [NBP2-13303] - Staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: SGPP1 Antibody [NBP2-13303] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PRKX Antibody
NBP1-87267
Western Blot: PRKX Antibody [NBP1-87267] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4
Immunocytochemistry/Immunofluorescence: PRKX Antibody [NBP1-87267] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus.
Immunohistochemistry-Paraffin: PRKX Antibody [NBP1-87267] - Staining of human small intestine shows strong nuclear positivity in glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PRPF8 Antibody
(JG57-38)
NBP2-75630
Western Blot: PRPF8 Antibody (JG57-38) [NBP2-75630] - Analysis of PRPF8 on SiHa (1) and A549 (2) cell lysate using anti-PRPF8 antibody at 1/1,000 dilution.
Immunocytochemistry/Immunofluorescence: PRPF8 Antibody (JG57-38) [NBP2-75630] - Staining PRPF8 in SiHa cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: PRPF8 Antibody (JG57-38) [NBP2-75630] - Analysis of paraffin-embedded rat brain tissue using anti-PRPF8 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
BMP-2
[Unconjugated]
355-BM/CF
BMP-2 [Unconjugated]
(121 Publications)
Species: Hu, Mu, Rt
GPKOW Antibody
NBP1-81800
GPKOW Antibody
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD

Publications for GPKOW Antibody (NBP1-81800)(1)


Reviews for GPKOW Antibody (NBP1-81800) (0)

There are no reviews for GPKOW Antibody (NBP1-81800). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GPKOW Antibody (NBP1-81800) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for GPKOW Antibody (NBP1-81800)

Discover related pathways, diseases and genes to GPKOW Antibody (NBP1-81800). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for GPKOW Antibody (NBP1-81800)

View related products by pathway.

PTMs for GPKOW Antibody (NBP1-81800)

Learn more about PTMs related to GPKOW Antibody (NBP1-81800).

Blogs on GPKOW

There are no specific blogs for GPKOW, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GPKOW Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol GPKOW