GPKOW Antibody

Images

 
Genetic Strategies: Western Blot: GPKOW Antibody [NBP1-81800] - Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-GPKOW antibody. Remaining relative ...read more
Immunocytochemistry/ Immunofluorescence: GPKOW Antibody [NBP1-81800] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: GPKOW Antibody [NBP1-81800] - Staining of human fallopian tube shows nuclear positivity in glandular cells.
Western Blot: GPKOW Antibody [NBP1-81800] - Analysis in human cell line A-549.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

GPKOW Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MPRPDEEQEKDKEDQPQGLVPGGAVVVLSGPHRGLYGKVEGLDPDNVRAMVRLAVGSRVVTVSEYYLRPVSQQEFDKNTLDLRQQNGTASSRKTLWNQELYIQQDNSERKRKHLPD
Marker
Nucleus Marker
Specificity
Specificity of human GPKOW antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GPKOW
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GPKOW Protein (NBP1-81800PEP)
Publications
Read Publication using NBP1-81800.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GPKOW Antibody

  • G patch domain and KOW motifs
  • GPATC5G patch domain and KOW motifs-containing protein
  • GPATCH5G patch domain-containing protein 5
  • Protein MOS2 homolog
  • Spp2
  • T54Protein T54

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-53181
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56630
Species: Hu
Applications: WB
NBP2-13920
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1626
Species: Hu
Applications: WB, ICC
NBP1-80876
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85269
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20403
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1768
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33466
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00001040-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-13303
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87267
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-75630
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
355-BM/CF
Species: Hu, Mu, Rt
NBP1-81800
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD

Publications for GPKOW Antibody (NBP1-81800)(1)

Reviews for GPKOW Antibody (NBP1-81800) (0)

There are no reviews for GPKOW Antibody (NBP1-81800). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GPKOW Antibody (NBP1-81800) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for GPKOW Antibody (NBP1-81800)

Discover related pathways, diseases and genes to GPKOW Antibody (NBP1-81800). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for GPKOW Antibody (NBP1-81800)

View related products by pathway.

PTMs for GPKOW Antibody (NBP1-81800)

Learn more about PTMs related to GPKOW Antibody (NBP1-81800).

Blogs on GPKOW

There are no specific blogs for GPKOW, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GPKOW Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GPKOW