Home » GPKOW » GPKOW Antibodies » GPKOW Antibody

GPKOW Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Knockdown Validated: GPKOW Antibody [NBP1-81800] - Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-GPKOW antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Genetic Strategies: Knockdown Validated: GPKOW Antibody [NBP1-81800] - Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-GPKOW antibody. Remaining relative ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: GPKOW Antibody [NBP1-81800] - Staining of human cerebral cortex, colon, kidney and pancreas using Anti-GPKOW antibody NBP1-81800 (A) shows similar protein ...read more
Independent Antibodies: Western Blot: GPKOW Antibody [NBP1-81800] - Analysis using Anti-GPKOW antibody NBP1-81800 (A) shows similar pattern to independent antibody NBP1-81801 (B).
Immunocytochemistry/ Immunofluorescence: GPKOW Antibody [NBP1-81800] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: GPKOW Antibody [NBP1-81800] - Staining of human kidney.
Western Blot: GPKOW Antibody [NBP1-81800] - Analysis in human cell line A-549.
Immunohistochemistry-Paraffin: GPKOW Antibody [NBP1-81800] - Staining of human fallopian tube shows nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: GPKOW Antibody [NBP1-81800] - Staining of human pancreas.
Immunohistochemistry-Paraffin: GPKOW Antibody [NBP1-81800] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: GPKOW Antibody [NBP1-81800] - Staining of human colon.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

    

Genetic Strategies

    

Order Details

100% Guarantee on every product

GPKOW Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MPRPDEEQEKDKEDQPQGLVPGGAVVVLSGPHRGLYGKVEGLDPDNVRAMVRLAVGSRVVTVSEYYLRPVSQQEFDKNTLDLRQQNGTASSRKTLWNQELYIQQDNSERKRKHLPD
Marker
Nucleus Marker
Specificity
Specificity of human GPKOW antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GPKOW
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GPKOW Protein (NBP1-81800PEP)
Publications
Read Publication using NBP1-81800.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GPKOW Antibody

  • G patch domain and KOW motifs
  • GPATC5G patch domain and KOW motifs-containing protein
  • GPATCH5G patch domain-containing protein 5
  • Protein MOS2 homolog
  • Spp2
  • T54Protein T54

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Osteopontin/OPN
Antibody [Unconjugate
AF808
Osteopontin/OPN was detected in immersion fixed C2C12 mouse myoblast cell line (left panel, positive stain) and mouse splenocytes (right panel, negative stain) using Goat Anti-Mouse Osteopontin/OPN Antigen Affinity-purified Polyclonal Antibody (Catalog # AF808) at 5 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm and secreted molecule. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Recombinant Mouse Osteopontin/OPN (Catalog # 441-OP), immobilized onto a microplate, supports the adhesion of the HEK293 human embryonic kidney cell line in a dose-dependent manner (orange line). Adhesion elicited by Recombinant Mouse Osteopontin/OPN (2 µg/mL) is neutralized (green line) by increasing concentrations of Mouse Osteopontin/OPN Antigen Affinity-purified Polyclonal Antibody (Catalog # AF808). The ND50 is typically 1‑3 µg/mL.
Osteopontin/OPN was detected in perfusion fixed frozen sections of mouse thymus using Mouse Osteopontin/OPN Antigen Affinity-purified Polyclonal Antibody (Catalog # AF808) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(7 Reviews)
(81 Publications)
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ICC, Neut, ELISA(Sta)
Sphingosine 1
phosphate phosphatase ...
NBP1-53181
Western Blot: Sphingosine 1 phosphate phosphatase 2 Antibody [NBP1-53181] - Titration: 2.5ug/ml Positive Control: HepG2 cell lysate.
Immunohistochemistry-Paraffin: Sphingosine 1 phosphate phosphatase 2 Antibody [NBP1-53181] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.
Species: Hu
Applications: WB, IHC, IHC-P
CXXC1 Antibody
NBP2-92895
Western Blot: CXXC1 Antibody [NBP2-92895] - Analysis of extracts of various cell lines, using CXXC1.Exposure time: 90s.
Immunocytochemistry/Immunofluorescence: CXXC1 Antibody [NBP2-92895] - Analysis of A549 cells using CXXC1. Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: CXXC1 Antibody [NBP2-92895] - Paraffin-embedded mouse lung using CXXC1.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
DHX16 Antibody
NBP2-13920
Immunocytochemistry/Immunofluorescence: DHX16 Antibody [NBP2-13920] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: DHX16 Antibody [NBP2-13920] - Staining in human testis and liver tissues using anti-DHX16 antibody. Corresponding DHX16 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: DHX16 Antibody [NBP2-13920] - Staining of human kidney shows strong nuclear positivity in renal tubules and glomeruli.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Chk2 Antibody
(73C175.1.1)
NB100-56546
Western Blot: Chk2 Antibody (73C175.1.1) [NB100-56546] - Western Blot: Chk2 Antibody (73C175.1.1) - Azide Free [NBP2-27403] - analysis of Chk2 in 293 cell lysate. A protein band of approximate molecular weight of 60-62 kDa is detected with Chk2 antibody at 2 ug/ml. Image using the Azide Free form of this antibody.
Immunocytochemistry/Immunofluorescence: Chk2 Antibody (73C175.1.1) [NB100-56546] - Hek293 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-Chk2 (73C175.1.1) at 5 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: Chk2 Antibody (73C175.1.1) [NB100-56546] - Staining of human spleen. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 10 ug/ml.
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
TMEM171 Antibody
NBP1-80876
Western Blot: TMEM171 Antibody [NBP1-80876] - Analysis in control (vector only transfected HEK293T lysate) and TMEM171 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: TMEM171 Antibody [NBP1-80876] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.
Species: Hu
Applications: WB, IHC, IHC-P
DHX38 Antibody
NBP1-85269
Western Blot: DHX38 Antibody [NBP1-85269] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/Immunofluorescence: DHX38 Antibody [NBP1-85269] - Staining of human cell line U-2 OS shows positivity in nucleus.
Immunohistochemistry-Paraffin: DHX38 Antibody [NBP1-85269] - Staining of human esophagus shows strong cytoplasmic and nuclear positivity in squamous epithelial cells.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
SLU7 Antibody
NBP2-20403
Western Blot: SLU7 Antibody [NBP2-20403] - Sample (30 ug of whole cell lysate) A: Non-transfected 293T lysates, B: hSLU7 transfected 293T lysates 7. 5% SDS PAGE gel, diluted at 1:10000.
Immunohistochemistry-Paraffin: SLU7 Antibody [NBP2-20403] - Immunohistochemical analysis of paraffin-embedded HBL435 xenograft, using antibody at 1:500 dilution.
Western Blot: SLU7 Antibody [NBP2-20403] - Sample (30 ug of whole cell lysate) A: A431 B: HeLa C: HepG2 7. 5% SDS PAGE gel, diluted at 1:1000.
(1 Publication)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
CDC2/CDK1 Antibody
NBP1-85729
Western Blot: CDC2/CDK1 Antibody [NBP1-85729] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/Immunofluorescence: CDC2/CDK1 Antibody [NBP1-85729] - Staining of human cell line U-251 MG shows localization to nucleus & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CDC2/CDK1 Antibody [NBP1-85729] - Staining in human tonsil and pancreas tissues. Corresponding CDK1 RNA-seq data are presented for the same tissues.
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
DHX8 Antibody
NBP2-13923
Western Blot: DHX8 Antibody [NBP2-13923] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.
Immunocytochemistry/Immunofluorescence: DHX8 Antibody [NBP2-13923] - Staining of human cell line HEK 293 shows positivity in nucleus but not nucleoli. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: DHX8 Antibody [NBP2-13923] - Staining of human placenta shows moderate nuclear positivity in trophoblastic cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Chk1 Antibody
NB100-464
Western Blot: Chk1 Antibody [NB100-464] - Knockout of ORC2 in HCT116 p53-/- cells. Western blot of ORC2 in HBEC and 293T cell lines. Ponceau S staining of total protein or immunoblot of Chk1 show equal loading of the pairs of lanes. Image collected and cropped by CiteAb from the following publication (https://elifesciences.org/articles/19084), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: Chk1 Antibody [NB100-464] - Section of human breast carcinoma. Antibody: Affinity purified rabbit anti-CHK1 used at a dilution of 1:1,000 (1ug/ml). Detection: DAB
Western Blot: Chk1 Antibody [NB100-464] - Detection of Human Chk1 by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa, 293T, Jurkat, and mouse TMCK cells. Antibodies: Affinity purified rabbit anti-Chk1 antibody NB100-464 used for WB at 0.4 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
(8 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
DNA Polymerase
delta, catalytic subu ...
NBP2-33466
Western Blot: DNA Polymerase delta, catalytic subunit Antibody [NBP2-33466] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/Immunofluorescence: DNA Polymerase delta, catalytic subunit Antibody [NBP2-33466] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: DNA Polymerase delta, catalytic subunit Antibody [NBP2-33466] - Staining of human lymph node shows strong nuclear positivity in germinal center cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
CDS1 Antibody
(2D10)
H00001040-M01
Western Blot: CDS1 Antibody (2D10) [H00001040-M01] - CDS1 monoclonal antibody (M01), clone 2D10. Analysis of CDS1 expression in human liver.
Immunocytochemistry/Immunofluorescence: CDS1 Antibody (2D10) [H00001040-M01] - Analysis of monoclonal antibody to CDS1 on HeLa cell. Antibody concentration 10 ug/ml.
ELISA: CDS1 Antibody (2D10) [H00001040-M01] - Detection limit for recombinant GST tagged CDS1 is 0.1 ng/ml as a capture antibody.
(1 Review)
(2 Publications)
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
SGPP1 Antibody
NBP1-91353
Western Blot: SGPP1 Antibody [NBP1-91353] - Differential expression of SGPP1 and SPL in normal FLS and RAFLS. Proteins from whole cell lysates were prepared for Western blot. Total PI3-kinase p85 subunit was used as a control for protein loading. Data presented are from a representative blot (upper panel) or the means +/- SE from three experiments (lower panel). For statistical comparative analyses, the samples stimulated with CoCl2 at 0 h were compared to those treated for indicated times. p < 0.05. Image collected and cropped by CiteAb from the following publication (http://www.hindawi.com/journals/mi/2015/436525/) licensed under a CC-BY licence.
Western Blot: SGPP1 Antibody [NBP1-91353] - Jurkat cell lysate, concentration 0.2-1 ug/ml.
(2 Publications)
Species: Hu, Mu
Applications: WB
PRKX Antibody
NBP1-87267
Western Blot: PRKX Antibody [NBP1-87267] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4
Immunocytochemistry/Immunofluorescence: PRKX Antibody [NBP1-87267] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus.
Immunohistochemistry-Paraffin: PRKX Antibody [NBP1-87267] - Staining of human small intestine shows strong nuclear positivity in glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PRPF8 Antibody
(JG57-38)
NBP2-75630
Western Blot: PRPF8 Antibody (JG57-38) [NBP2-75630] - Analysis of PRPF8 on SiHa (1) and A549 (2) cell lysate using anti-PRPF8 antibody at 1/1,000 dilution.
Immunocytochemistry/Immunofluorescence: PRPF8 Antibody (JG57-38) [NBP2-75630] - Staining PRPF8 in SiHa cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: PRPF8 Antibody (JG57-38) [NBP2-75630] - Analysis of paraffin-embedded rat brain tissue using anti-PRPF8 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
BMP-2
[Unconjugated]
355-BM
BMP-2 [Unconjugated]
(9 Reviews)
(155 Publications)
Species: Hu, Mu, Rt
GPKOW Antibody
NBP1-81800
GPKOW Antibody
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD

Publications for GPKOW Antibody (NBP1-81800)(1)


Reviews for GPKOW Antibody (NBP1-81800) (0)

There are no reviews for GPKOW Antibody (NBP1-81800). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GPKOW Antibody (NBP1-81800) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional GPKOW Products

Bioinformatics Tool for GPKOW Antibody (NBP1-81800)

Discover related pathways, diseases and genes to GPKOW Antibody (NBP1-81800). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for GPKOW Antibody (NBP1-81800)

View related products by pathway.

PTMs for GPKOW Antibody (NBP1-81800)

Learn more about PTMs related to GPKOW Antibody (NBP1-81800).

Blogs on GPKOW

There are no specific blogs for GPKOW, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GPKOW Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol GPKOW