Home » PHF5A » PHF5A Antibodies » PHF5A Antibody

PHF5A Antibody

 (2 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: PHF5A Antibody [NBP1-88591] - Analysis in HeLa cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-PHF5A antibody. Remaining relative intensity is presented. Loading control: anti-GAPDH.
Genetic Strategies: Western Blot: PHF5A Antibody [NBP1-88591] - Analysis in HeLa cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-PHF5A antibody. Remaining relative ...read more
Immunocytochemistry/ Immunofluorescence: PHF5A Antibody [NBP1-88591] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PHF5A Antibody [NBP1-88591] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: PHF5A Antibody [NBP1-88591] - Staining of human kidney shows moderate nuclear positivity in cells in tubules.
Immunohistochemistry-Paraffin: PHF5A Antibody [NBP1-88591] - Staining of human cerebral cortex shows strong nuclear positivity in neurons
Immunohistochemistry-Paraffin: PHF5A Antibody [NBP1-88591] - Staining of human rectum shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

    

Order Details

100% Guarantee on every product

PHF5A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERK
Specificity
Specificity of human PHF5A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PHF5A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Knockdown Validated
Application Notes
WB, ICC/IF reported in scientific literature (PMID: 26244496). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PHF5A Protein (NBP1-88591PEP)
Publications
Read Publications using
NBP1-88591 in the following applications:

  • ICC/IF
    1 publication
  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 26244496).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PHF5A Antibody

  • bK223H9.2
  • INI
  • MGC1346
  • PHD finger protein 5A
  • PHD finger-like domain protein 5A
  • PHD finger-like domain-containing protein 5A
  • PHD-finger 5a
  • Rds3
  • SAP14b
  • SF3b14bSplicing factor 3B-associated 14 kDa protein
  • splicing factor 3B associated 14 kDa protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

SNF5 Antibody
NBP1-90013
Western Blot: SNF5 Antibody [NBP1-90013] - Analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunohistochemistry-Paraffin: SNF5 Antibody [NBP1-90013] - Staining of human liver shows very weak positivity in hepatocytes as expected.
Western Blot: SNF5 Antibody [NBP1-90013] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, KD
RalA/RalB Antibody
AF3204
Western blot shows lysates of U937 human histiocytic lymphoma cell line and NIH-3T3 mouse embryonic fibroblast cell line. PVDF membrane was probed with 1 µg/mL Goat Anti-Human/Mouse/Rat RalA/RalB Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3204) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). For additional reference, recombinant human RalA and RalB (5 ng/lane) were included. A specific band for RalA/RalB was detected at approximately 25 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB
LEDGF Antibody
(762815)
MAB3468
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line. Gels were loaded with 40 µg of cytoplasmic (Cyto) and 20 µg of nuclear (Nuc) extracts. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human LEDGF Monoclonal Antibody (Catalog # MAB3468) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). Specific bands were detected for LEDGF p75 at approximately 75 kDa and LEDGF p52 at approximately 50-55 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
LEDGF was detected in immersion fixed HeLa human cervical epithelial carcinoma cell line using Mouse Anti-Human LEDGF Monoclonal Antibody (Catalog # MAB3468) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red, upper panel; Catalog # NL007) and counterstained with DAPI (blue, lower panel). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(1 Review)
(1 Publication)
Species: Hu
Applications: WB, ICC
S5a/Angiocidin
Antibody
NBP2-37888
Western Blot: S5a/Angiocidin Antibody [NBP2-37888] - Analysis in control (vector only transfected HEK293T lysate) and PSMD4 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: S5a/Angiocidin Antibody [NBP2-37888] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: S5a/Angiocidin Antibody [NBP2-37888] - Staining of human liver.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
ATF6 beta Antibody
NBP1-91687
Western Blot: ATF6 beta Antibody [NBP1-91687] - Analysis in human cell line SK-MEL-30 and human cell line PC-3.
Immunohistochemistry-Paraffin: ATF6 beta Antibody [NBP1-91687] - Staining of human placenta shows moderate nuclear positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: ATF6 beta Antibody [NBP1-91687] - Staining of human Fallopian tube shows moderate nuclear positivity in glandular cells.
(1 Publication)
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Melanocortin-4 R
Antibody
NBP2-41103
Western Blot: Melanocortin-4 R Antibody [NBP2-41103] - Western blot analysis of MC4R in rat brain tissue lysate with MC4R antibody at 1 ug/mL in (A) the absence and (B) the presence of blocking peptide.
Immunohistochemistry-Paraffin: Melanocortin-4 R Antibody [NBP2-41103] - human brain tissue with MC4R antibody at 2.5 ug/mL.
Immunofluorescence: Melanocortin-4 R Antibody [NBP2-41103] - Human Brain cells with MC4R antibody at 20 ug/mL.
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
G protein alpha-13
Antibody
NBP3-03844
Western Blot: G protein alpha-13 Antibody [NBP3-03844] - Analysis of extracts from normal (control) and GNA13 knockout (KO) HeLa cells, using G protein alpha-13 antibody at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.
Immunocytochemistry/Immunofluorescence: G protein alpha-13 Antibody [NBP3-03844] - Analysis of NIH-3T3 cells using G protein alpha-13 antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: G protein alpha-13 Antibody [NBP3-03844] - Paraffin-embedded human stomach using G protein alpha-13 antibody (40x lens).
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
p53 Antibody (PAb
240)
NB200-103
Western Blot: p53 Antibody (PAb 240) [NB200-103] - Analysis of p53 in MCF7 and HeLa lystates. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: p53 Antibody (PAb 240) [NB200-103] - PC12 cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.5% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-p53 Antibody (PAb 240) NB200-103 at 2 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: p53 Antibody (PAb 240) [NB200-103] - p53 was detected in immersion fixed paraffin-embedded sections of human prostate cancer using anti-human mouse monoclonal antibody (Catalog # NB200-103) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue). Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(3 Reviews)
(28 Publications)
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
EphA3
640-A3
EphA3
(5 Publications)
Species: Mu
NUP155 Antibody
NBP1-82960
Western Blot: NUP155 Antibody [NBP1-82960] - Analysis in human cell line HeLa and human cell line MCF-7.
Immunocytochemistry/Immunofluorescence: NUP155 Antibody [NBP1-82960] - Staining of human cell line U-2 OS shows localization to nuclear membrane. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: NUP155 Antibody [NBP1-82960] - Staining of human testis shows moderate nuclear membrane positivity in cells in seminiferous ducts.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
SAP130 Antibody
(JG63-53)
NBP2-76869
Western Blot: SAP130 Antibody (JG63-53) [NBP2-76869] - Western blot analysis of SF3B3 on Jurkat and Hela cells lysates using anti-SF3B3 antibody at 1/1,000 dilution.
Immunocytochemistry/Immunofluorescence: SAP130 Antibody (JG63-53) [NBP2-76869] - ICC staining SF3B3 (green) in A549 cells. The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry: SAP130 Antibody (JG63-53) [NBP2-76869] - Immunohistochemical analysis of paraffin-embedded rat brain tissue using anti-SF3B3 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Recombinant Human
POMT1 GST (N-Term) Pr ...
H00010585-Q01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
CD4 Antibody
NBP1-19371
Immunohistochemistry: CD4 Antibody [NBP1-19371] - Increased CD3+ and CD4+ T-cell occurrence in the brainstem of SHR-72 transgenic rat model for tauopathies. (A-D) Immunofluorescence staining showed CD4+ T-cells in SHR-72 transgenic animals. (E- H) Immunofluorescence staining showed more perivascular than brain parenchyma infiltrating CD4+ T-cells in SHR-72 transgenic animals. PLoS One. 2019 May 23;14(5):e0217216. doi: 10.1371/journal.pone.0217216.
Immunohistochemistry: CD4 Antibody [NBP1-19371] - DBZ inhibits the accumulation of CD4+ T cells and Th2 differentiation in the AAAs. (B) The representation of immunohistochemical staining for CD4+ in abdominal aorta from four groups (left). Bar graphs show the percentage of CD4+ positive cell areas (right; n=3 per group). Bar: 50 um.
Western Blot: CD4 Antibody [NBP1-19371] - CD4 antibody was tested in the following cell lysates: 1) human spleen 2) human tonsil 3) human placenta 4) human kidney 5) human liver 6) mouse spleen 7) mouse placenta 8) rat placenta.
(9 Reviews)
(29 Publications)
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
SF3B4 Antibody
(3A1)
NBP1-92692
Western Blot: SF3B4 Antibody (3A1) [NBP1-92692] - Analysis of different cell lysates, cytosol or nuclear enriched fractions, using mouse mAb to splicing factor SF3B4, NBP1-92692, dilution 1:1,000 in green: [1] protein standard (red), [2] NIH-3T3 cytosolic fraction [3] NIH-3T3 nuclear fraction [4] HeLa cytosolic and [5] HeLa nuclear fractions. Strong single band at 49kDa represents the SF3B4 protein, which is expressed exclusively in the nuclei. The same blot was simultaneously probed with rabbit pAb to GAPDH, dilution 1:20,000, in red. The 37kDa band corresponds to GAPDH protein, detected mainly in the cytosolic fractions of these cells.
Immunocytochemistry/Immunofluorescence: SF3B4 Antibody (3A1) [NBP1-92692] - Analysis of HeLa cells stained with mouse mAb to splicing factor SF3B4, NBP1-92692, dilution 1:1,000 in red, and costained with chicken pAb to vimentin, dilution 1:10,000, in green. The blue is DAPI staining of nuclear DNA. The NBP1-92692 antibody reveals strong granular staining of the nuclei, while the vimentin antibody specifically labels cytoplasmic intermediate filaments.
Immunocytochemistry/Immunofluorescence: SF3B4 Antibody (3A1) [NBP1-92692] - HeLa cells stained with NBP1-92692 (red), chicken antibody to Vimentin (NB300-223, green) and DNA (blue, stained with DAPI). The SF3B4 (3A1) antibody reveals strong granular nuclear staining which is a little different from the DNA stain and presumably reflects splicosomal complexes. The Vimentin antibody stains the cytoplasmic intermediate filament network of the HeLa cells.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
5-HT2B Antibody
NBP1-90322
Immunocytochemistry/Immunofluorescence: 5-HT2B Antibody [NBP1-90322] - Staining of human cell line SK-MEL-30 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: 5-HT2B Antibody [NBP1-90322] - Staining in human endometrium and skeletal muscle tissues. Corresponding HTR2B RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: 5-HT2B Antibody [NBP1-90322] - Staining of human endometrium shows moderate membranous positivity in glandular cells.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
p97/VCP Antibody
NB100-1558
Western Blot: p97/VCP Antibody [NB100-1558] - Zymographic assay of gelatinase activity. Medium supernatants of 20ml culture medium (medium control) as well as 20 ml conditioned medium from 107 U937 cells, pMTH1-U937 cells and asCD11b-U937 cells in the absence or presence of 5nM TPA for 72 h, respectively, were 18-fold concentrated and subjected to SDS-PAGE containing 2 mg/ml of gelatine. Following incubation with MMP enzyme buffer, the gels were stained with 0.4% Coomassie blue and afterwards destained again to visualize the appearance of gelatinase activity by light bands against the dark background. The molecular weight markers on both sides of the gels indicate the size of the MMPs exhibiting gelatinase activities. Image collected and cropped by CiteAb from the following publication (http://biosignaling.biomedcentral.com/articles/10.1186/1478-811X-10-13) licensed under a CC-BY licence.
Western Blot: p97/VCP Antibody [NB100-1558] - Whole cell lysate (15 ug) from HeLa, 293T, Jurkat, mouse TCMK-1, and mouse NIH3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit antiVCP antibody used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 1 second.
Western Blot: p97/VCP Antibody [NB100-1558] - Detection of human VCP by western blot of immunoprecipitates. Samples: Whole cell lysate (1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-VCP antibody NB100-1558 used for IP at 3 ug per reaction. VCP was also immunoprecipitated by rabbit anti-VCP antibody NB100-1557. For blotting immunoprecipitated VCP, NB100-1558 was used at 0.4 ug/ml. Detection: Chemiluminescence with an exposure time of 1 second.
(10 Publications)
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IP

Publications for PHF5A Antibody (NBP1-88591)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 3 applications: ICC/IF, IHC, WB.


Filter By Application
ICC/IF
(1)
IHC
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for PHF5A Antibody (NBP1-88591) (0)

There are no reviews for PHF5A Antibody (NBP1-88591). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PHF5A Antibody (NBP1-88591) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional PHF5A Products

Bioinformatics Tool for PHF5A Antibody (NBP1-88591)

Discover related pathways, diseases and genes to PHF5A Antibody (NBP1-88591). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PHF5A Antibody (NBP1-88591)

Discover more about diseases related to PHF5A Antibody (NBP1-88591).
 

Pathways for PHF5A Antibody (NBP1-88591)

View related products by pathway.

Research Areas for PHF5A Antibody (NBP1-88591)

Find related products by research area.

Blogs on PHF5A

There are no specific blogs for PHF5A, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PHF5A Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol PHF5A