PHF5A Antibody

Images

 
Western Blot: PHF5A Antibody [NBP1-88591] - Analysis in human cell line HeLa.
Immunocytochemistry/ Immunofluorescence: PHF5A Antibody [NBP1-88591] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: PHF5A Antibody [NBP1-88591] - Staining of human duodenum shows nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PHF5A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PHF5A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PHF5A Protein (NBP1-88591PEP)
Publications
Read Publication using
NBP1-88591 in the following applications:

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 26244496).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PHF5A Antibody

  • bK223H9.2
  • INI
  • MGC1346
  • PHD finger protein 5A
  • PHD finger-like domain protein 5A
  • PHD finger-like domain-containing protein 5A
  • PHD-finger 5a
  • Rds3
  • SAP14b
  • SF3b14bSplicing factor 3B-associated 14 kDa protein
  • splicing factor 3B associated 14 kDa protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006598-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
AF3204
Species: Hu, Mu, Rt
Applications: WB
PPS046
Species: Hu, Mu, Rt, Bv, Ca, Ch, GP, Pm, Ze
Applications: WB
NB110-40561
Species: Hu
Applications: WB, IP
AF5540
Species: Mu
Applications: WB
NBP1-91687
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-41103
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-89810
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
640-A3
Species: Mu
NBP1-82960
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1077
Species: Hu
Applications: WB, PEP-ELISA
NBP2-57200
Species: Hu
Applications: ICC/IF
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-92692
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP1-55429
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-11433
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-88591
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PHF5A Antibody (NBP1-88591)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for PHF5A Antibody (NBP1-88591) (0)

There are no reviews for PHF5A Antibody (NBP1-88591). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PHF5A Antibody (NBP1-88591) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PHF5A Products

Bioinformatics Tool for PHF5A Antibody (NBP1-88591)

Discover related pathways, diseases and genes to PHF5A Antibody (NBP1-88591). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PHF5A Antibody (NBP1-88591)

Discover more about diseases related to PHF5A Antibody (NBP1-88591).
 

Pathways for PHF5A Antibody (NBP1-88591)

View related products by pathway.

Research Areas for PHF5A Antibody (NBP1-88591)

Find related products by research area.

Blogs on PHF5A

There are no specific blogs for PHF5A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PHF5A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PHF5A