![Western Blot: PHF5A Antibody [NBP1-88591] - Analysis in HeLa cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-PHF5A antibody. Remaining relative intensity is presented. Loading control: anti-GAPDH.](http://images.novusbio.com/fullsize2/PHF5A-Antibody-Western-Blot-NBP1-88591-img0010.jpg "Western Blot: PHF5A Antibody [NBP1-88591] - Analysis in HeLa cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-PHF5A antibody. Remaining relative intensity is presented. Loading control: anti-GAPDH.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, IHC-P, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERK |
| Specificity | Specificity of human PHF5A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Predicted Species | Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PHF5A |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Diseases for PHF5A Antibody (NBP1-88591)Discover more about diseases related to PHF5A Antibody (NBP1-88591).
| Pathways for PHF5A Antibody (NBP1-88591)View related products by pathway.
|
Research Areas for PHF5A Antibody (NBP1-88591)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PHF5A |
![Immunocytochemistry/Immunofluorescence: PHF5A Antibody [NBP1-88591] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.](http://images.novusbio.com/fullsize2/PHF5A-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88591-img0009.jpg "Immunocytochemistry/Immunofluorescence: PHF5A Antibody [NBP1-88591] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: PHF5A Antibody [NBP1-88591] - Staining of human duodenum shows nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize2/PHF5A-Antibody-Immunohistochemistry-Paraffin-NBP1-88591-img0008.jpg "Immunohistochemistry-Paraffin: PHF5A Antibody [NBP1-88591] - Staining of human duodenum shows nuclear positivity in glandular cells.")
![Western Blot: SNF5 Antibody [NBP1-90014] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize2/SNF5-Antibody-Western-Blot-NBP1-90014-img0009.jpg)
![Immunocytochemistry/Immunofluorescence: SNF5 Antibody [NBP1-90014] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli. Antibody staining is shown in green.](http://images.novusbio.com/fullsize2/SNF5-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90014-img0006.jpg)
![Immunohistochemistry-Paraffin: SNF5 Antibody [NBP1-90014] - Staining of human tonsil shows nuclear positivity.](http://images.novusbio.com/fullsize2/SNF5-Antibody-Immunohistochemistry-Paraffin-NBP1-90014-img0011.jpg)
![Western Blot: LEDGF Antibody [NB110-40561] - Detection of Human LEDGF/p75 on HeLa whole cell lysate using NB110-40561. LEDGF/p75 was also immunoprecipitated by another rabbit anti-LEDGF/p75 antibody.](http://images.novusbio.com/fullsize2/LEDGF-Antibody-Western-Blot-NB110-40561-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: Proteasome 19S S5A Antibody [NBP1-90821] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm. Antibody staining is shown in green.](http://images.novusbio.com/fullsize2/Proteasome-19S-S5A-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90821-img0007.jpg)
![Immunohistochemistry-Paraffin: Proteasome 19S S5A Antibody [NBP1-90821] - Staining in human testis and pancreas tissues using anti-PSMD4 antibody. Corresponding PSMD4 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/Proteasome-19S-S5A-Antibody-Immunohistochemistry-Paraffin-NBP1-90821-img0012.jpg)
![Immunohistochemistry-Paraffin: Proteasome 19S S5A Antibody [NBP1-90821] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize2/Proteasome-19S-S5A-Antibody-Immunohistochemistry-Paraffin-NBP1-90821-img0010.jpg)
![Western Blot: ATF6 beta Antibody [NBP1-91687] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4](http://images.novusbio.com/fullsize2/ATF6-beta-Antibody-Western-Blot-NBP1-91687-img0007.jpg)
![Immunohistochemistry-Paraffin: ATF6 beta Antibody [NBP1-91687] - Staining of human kidney shows moderate cytoplasmic and nuclear positivity in cells in tubules.](http://images.novusbio.com/fullsize2/ATF6-beta-Antibody-Immunohistochemistry-Paraffin-NBP1-91687-img0002.jpg)
![Western Blot: ATF6 beta Antibody [NBP1-91687] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/fullsize2/ATF6-beta-Antibody-Western-Blot-NBP1-91687-img0005.jpg)
![Western Blot: Melanocortin-4 R Antibody [NBP2-41103] - Western blot analysis of MC4R in rat brain tissue lysate with MC4R antibody at 1 ug/mL in (A) the absence and (B) the presence of blocking peptide.](http://images.novusbio.com/fullsize2/Melanocortin-4-R-Antibody-Western-Blot-NBP2-41103-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: Melanocortin-4 R Antibody [NBP2-41103] - Immunofluorescence of MC4R in Human Brain cells with MC4R antibody at 20 ug/mL.](http://images.novusbio.com/fullsize2/Melanocortin-4 R Antibody-Immunocytochemistry-Immunofluorescence-NBP2-41103-img0003.jpg)
![Immunohistochemistry: Melanocortin-4 R Antibody [NBP2-41103] - Immunohistochemistry of MC4R in human brain tissue with MC4R antibody at 2.5 ug/mL.](http://images.novusbio.com/fullsize2/Melanocortin-4-R-Antibody-Immunohistochemistry-NBP2-41103-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: G protein alpha-13 Antibody [NBP1-89810] - Immunofluorescent staining of human cell line SH-SY5Y shows localization to cytosol.](http://images.novusbio.com/fullsize2/G protein alpha-13 Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89810-img0008.jpg)
![Immunohistochemistry-Paraffin: G protein alpha-13 Antibody [NBP1-89810] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize2/G-protein-alpha-13-Antibody-Immunohistochemistry-Paraffin-NBP1-89810-img0007.jpg)
![Western Blot: p53 Antibody (PAb 240) [NB200-103] - WB analysis of p53 in MCF7 and HeLa lystates. Image courtesy of anonymous customer product review.](http://images.novusbio.com/fullsize2/p53-Antibody-(PAb-240)-Western-Blot-NB200-103-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: p53 Antibody (PAb 240) [NB200-103] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-p53 (PAb 240) [NB200-103] at a 1:200 dilution overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.](http://images.novusbio.com/fullsize2/p53-Antibody-(PAb-240)-Immunocytochemistry-Immunofluorescence-NB200-103-img0004.jpg)
![Immunohistochemistry-Paraffin: p53 Antibody (PAb 240) [NB200-103] - p53 was detected in immersion fixed paraffin-embedded sections of human prostate cancer using anti-human mouse monoclonal antibody (Catalog # NB200-103) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue).Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.](http://images.novusbio.com/fullsize2/p53-Antibody-(PAb-240)-Immunohistochemistry-Paraffin-NB200-103-img0005.jpg)
![Western Blot: NUP155 Antibody [NBP1-82960] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize2/NUP155-Antibody-Western-Blot-NBP1-82960-img0006.jpg)
![Immunocytochemistry/Immunofluorescence: NUP155 Antibody [NBP1-82960] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear membrane.](http://images.novusbio.com/fullsize2/NUP155-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82960-img0008.jpg)
![Immunohistochemistry-Paraffin: NUP155 Antibody [NBP1-82960] - Staining in human testis and liver tissues using anti-NUP155 antibody. Corresponding NUP155 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/NUP155-Antibody-Immunohistochemistry-Paraffin-NBP1-82960-img0011.jpg)
![Western Blot: SAP130 Antibody [NB100-1077] - Staining (0.1ug/ml) of nuclear lysate from HeLa cells (RIPA buffer, 30ug total protein per lane). Primary incubated for 1 hour. Detected by western blot using chemiluminescence](http://images.novusbio.com/fullsize2/SAP130-Antibody-Western-Blot-NB100-1077-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: POMT1 Antibody [NBP2-57200] - Staining of human cell line MCF7 shows localization to the Golgi apparatus.](http://images.novusbio.com/fullsize2/POMT1 Antibody-Immunocytochemistry-Immunofluorescence-NBP2-57200-img0001.jpg)
![Western Blot: CD4 Antibody [NBP1-19371] - CD4 antibody was tested in the following cell lysates: Lane 1) human spleen 2) human tonsil 3) human placenta 4) human kidney 5) human liver 6) mouse spleen 7) mouse placenta 8) rat placenta.](http://images.novusbio.com/fullsize2/CD4-Antibody-Western-Blot-NBP1-19371-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: CD4 Antibody [NBP1-19371] - CD4 antibody was tested in Jurkat cells with Dylight 488 (green). Nuclei were counterstained with DAPI (blue).](http://images.novusbio.com/fullsize2/CD4-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-19371-img0005.jpg)
![Immunohistochemistry-Frozen: CD4 Antibody [NBP1-19371] - Staining in mouse liver tissue.](http://images.novusbio.com/fullsize2/CD4-Antibody-Immunohistochemistry-Frozen-NBP1-19371-img0013.jpg)
![Western Blot: SF3B4 Antibody (3A1) [NBP1-92692] - Analysis of different cell lysates, cytosol or nuclear enriched fractions, using mouse mAb to splicing factor SF3B4, NBP1-92692, dilution 1:1,000 in green: [1] protein standard (red), [2] NIH-3T3 cytosolic fraction [3] NIH-3T3 nuclear fraction [4] HeLa cytosolic and [5] HeLa nuclear fractions. Strong single band at 49kDa represents the SF3B4 protein, which is expressed exclusively in the nuclei. The same blot was simultaneously probed with rabbit pAb to GAPDH, dilution 1:20,000, in red. The 37kDa band corresponds to GAPDH protein, detected mainly in the cytosolic fractions of these cells.](http://images.novusbio.com/fullsize2/SF3B4-Antibody-(3A1)-Western-Blot-NBP1-92692-img0005.jpg)
![Immunocytochemistry/Immunofluorescence: SF3B4 Antibody (3A1) [NBP1-92692] - Analysis of HeLa cells stained with mouse mAb to splicing factor SF3B4, NBP1-92692, dilution 1:1,000 in red, and costained with chicken pAb to vimentin, dilution 1:10,000, in green. The blue is DAPI staining of nuclear DNA. The NBP1-92692 antibody reveals strong granular staining of the nuclei, while the vimentin antibody specifically labels cytoplasmic intermediate filaments.](http://images.novusbio.com/fullsize2/SF3B4-Antibody-(3A1)-Immunocytochemistry-Immunofluorescence-NBP1-92692-img0004.jpg)
![Immunocytochemistry/Immunofluorescence: SF3B4 Antibody (3A1) [NBP1-92692] - HeLa cells stained with NBP1-92692 (red), chicken antibody to Vimentin (NB300-223, green) and DNA (blue, stained with DAPI). The SF3B4 (3A1) antibody reveals strong granular nuclear staining which is a little different from the DNA stain and presumably reflects splicosomal complexes. The Vimentin antibody stains the cytoplasmic intermediate filament network of the HeLa cells.](http://images.novusbio.com/fullsize2/SF3B4-Antibody-(3A1)-Immunocytochemistry-Immunofluorescence-NBP1-92692-img0003.jpg)
![Western Blot: 5-HT2B Antibody [NBP1-55429] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.](http://images.novusbio.com/fullsize2/5-HT2B-Antibody-Western-Blot-NBP1-55429-img0004.jpg)
![Immunocytochemistry/Immunofluorescence: 5-HT2B Antibody [NBP1-55429] - Spinal Cord, ventral horns of mouse, 1.3ug/mL Image Submitted By: Timur Mavlyutov, PhD Department of Pharmacology University of Wisconsin Medical School](http://images.novusbio.com/fullsize2/5-HT2B-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-55429-img0002.jpg)
![Western Blot: 5-HT2B Antibody [NBP1-55429] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.](http://images.novusbio.com/fullsize2/5-HT2B-Antibody-Western-Blot-NBP1-55429-img0001.jpg)
![Western Blot: p97/VCP Antibody [NB100-1558] - Whole cell lysate (15 ug) from HeLa, 293T, Jurkat, mouse TCMK-1, and mouse NIH3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit antiVCP antibody used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 1 second.](http://images.novusbio.com/fullsize2/p97-VCP-Antibody-Western-Blot-NB100-1558-img0012.jpg)
![Immunoprecipitation: p97/VCP Antibody [NB100-1558] - Detection of Human and Mouse VCP on HeLa whole cell lysate using NB100-1558. VCP was also immunoprecipitated using rabbit anti-VCP antibodies NB100-1557 and another VCP antibody at 3 mcg/mg lysate.](http://images.novusbio.com/fullsize2/p97-VCP-Antibody-Immunoprecipitation-NB100-1558-img0003.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0006.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.")