Sphingosine 1 phosphate phosphatase 2 Antibody


Western Blot: Sphingosine 1 phosphate phosphatase 2 Antibody [NBP1-53181] - Titration: 2.5ug/ml Positive Control: HepG2 cell lysate.
Immunohistochemistry-Paraffin: Sphingosine 1 phosphate phosphatase 2 Antibody [NBP1-53181] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) ...read more

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

Sphingosine 1 phosphate phosphatase 2 Antibody Summary

Synthetic peptides corresponding to SGPP2(sphingosine-1-phosphate phosphotase 2) The peptide sequence was selected from the C terminal of SGPP2. Peptide sequence SKPAESLPVIQNIPPLTTYMLVLGLTKFAVGIVLILLVRQLVQNLSLQVL.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against SGPP2 and was validated on Western Blot and immunohistochemistry-P
Theoretical MW
37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Sphingosine 1 phosphate phosphatase 2 Antibody

  • EC 3.1.3
  • EC 3.1.3.-
  • FLJ39004
  • hSPP2
  • sphingosine 1-phosphate phosphohydrolase 2
  • Sphingosine-1-phosphatase 2
  • sphingosine-1-phosphate phosphatase 2
  • Spp2
  • SPP2sphingosine-1-phosphate phosphotase 2
  • SPPase2


In vitro, SGPP2 has high phosphohydrolase activity against dihydrosphingosine-1-phosphate and sphingosine-1-phosphate (S1P).


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, PEP-ELISA
Species: Mu
Applications: WB, IHC, Block, ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: Flow, IHC, CyTOF-ready
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC-P, IF
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut

Publications for Sphingosine 1 phosphate phosphatase 2 Antibody (NBP1-53181) (0)

There are no publications for Sphingosine 1 phosphate phosphatase 2 Antibody (NBP1-53181).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Sphingosine 1 phosphate phosphatase 2 Antibody (NBP1-53181) (0)

There are no reviews for Sphingosine 1 phosphate phosphatase 2 Antibody (NBP1-53181). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Sphingosine 1 phosphate phosphatase 2 Antibody (NBP1-53181) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for Sphingosine 1 phosphate phosphatase 2 Antibody (NBP1-53181)

Discover related pathways, diseases and genes to Sphingosine 1 phosphate phosphatase 2 Antibody (NBP1-53181). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Sphingosine 1 phosphate phosphatase 2 Antibody (NBP1-53181)

Discover more about diseases related to Sphingosine 1 phosphate phosphatase 2 Antibody (NBP1-53181).

Pathways for Sphingosine 1 phosphate phosphatase 2 Antibody (NBP1-53181)

View related products by pathway.

Blogs on Sphingosine 1 phosphate phosphatase 2

There are no specific blogs for Sphingosine 1 phosphate phosphatase 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Sphingosine 1 phosphate phosphatase 2 Antibody and receive a gift card or discount.


Gene Symbol SGPP2