Serum Response Factor SRF Antibody

Images

 
Western Blot: Serum Response Factor SRF Antibody [NBP1-87814] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: MOLT-4
Immunohistochemistry-Paraffin: Serum Response Factor SRF Antibody [NBP1-87814] - Staining of human kidney shows strong nuclear positivity in cells in glomeruli.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Serum Response Factor SRF Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LPTSFTLMPGGAVAQQVPVQAIQVHQAPQQASPSRDSSTDLTQTSSSGTVTLPATIMTSSVPTTVGGHMMYPSPHAVMYAPTSGLGDGSLTVLNAFSQAPSTMQVSHSQVQEPGGVPQVFLTASSGTVQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SRF
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Serum Response Factor SRF Protein (NBP1-87814PEP)
Publications
Read Publication using NBP1-87814.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Serum Response Factor SRF Antibody

  • MCM1
  • serum response factor (c-fos serum response element-binding transcriptionfactor)
  • serum response factor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, ICC
NBP1-88498
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4028
Species: Hu, Mu
Applications: WB
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
PPS021
Species: Hu, Mu, Rt, Ca, Pm, Ze
Applications: WB
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-30646
Species: Hu
Applications: WB, IHC, IHC-P
PPS021
Species: Hu, Mu, Rt, Ca, Pm, Ze
Applications: WB
H00023415-R03
Species: Hu
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NB600-507
Species: Hu, Mu
Applications: WB, PEP-ELISA
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
H00004205-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-410
Species: Hu, Mu
Applications: WB, IP
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-87092
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87814
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Serum Response Factor SRF Antibody (NBP1-87814)(1)

Reviews for Serum Response Factor SRF Antibody (NBP1-87814) (0)

There are no reviews for Serum Response Factor SRF Antibody (NBP1-87814). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Serum Response Factor SRF Antibody (NBP1-87814) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Serum Response Factor SRF Products

Bioinformatics Tool for Serum Response Factor SRF Antibody (NBP1-87814)

Discover related pathways, diseases and genes to Serum Response Factor SRF Antibody (NBP1-87814). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Serum Response Factor SRF Antibody (NBP1-87814)

Discover more about diseases related to Serum Response Factor SRF Antibody (NBP1-87814).
 

Pathways for Serum Response Factor SRF Antibody (NBP1-87814)

View related products by pathway.

PTMs for Serum Response Factor SRF Antibody (NBP1-87814)

Learn more about PTMs related to Serum Response Factor SRF Antibody (NBP1-87814).

Blogs on Serum Response Factor SRF

There are no specific blogs for Serum Response Factor SRF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Serum Response Factor SRF Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SRF