Serpin E1/PAI-1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Serpin E1/PAI-1 Antibody [NBP2-13298] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemistry-Paraffin: Serpin E1/PAI-1 Antibody [NBP2-13298] - Staining of human colon shows strong cytoplasmic positivity in endothelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Serpin E1/PAI-1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RLFHKSDGSTVSVPMMAQTNKFNYTEFTTPDGHYYDILELPYHGDTLSMF IAAPYEKEVPLSALTNILSAQLISHWKGNMTRLPRLLVLPKFSLETEVDL RKPLENLGMTDMFRQFQADF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SERPINE1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Serpin E1/PAI-1 Protein (NBP2-13298PEP)
Publications
Read Publications using
NBP2-13298 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (84%). Human reactivity reported in scientific literature (PMID: 25387487).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Serpin E1/PAI-1 Antibody

  • Endothelial plasminogen activator inhibitor
  • Nexin
  • PAI1
  • PAI-1
  • PAI1PAI-1
  • PAISerpin E1
  • PLANH1
  • PLANH1plasminogen activator inhibitor 1
  • serine (or cysteine) proteinase inhibitor, clade E (nexin, plasminogenactivator inhibitor type 1), member 1
  • Serpin E1
  • serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitortype 1), member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-930
Species: Hu, Ba
Applications: WB, ELISA
NBP2-20648
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
AF1310
Species: Hu
Applications: WB, IHC, IP
NBP1-80633
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-07799
Species: Hu
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NB600-586
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB8550
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC, KO
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
AF1267
Species: Hu
Applications: WB, IP, Neut
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
H00005554-R02
Species: Hu
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP2-13298
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Serpin E1/PAI-1 Antibody (NBP2-13298)(3)

Reviews for Serpin E1/PAI-1 Antibody (NBP2-13298) (0)

There are no reviews for Serpin E1/PAI-1 Antibody (NBP2-13298). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Serpin E1/PAI-1 Antibody (NBP2-13298) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Serpin E1/PAI-1 Products

Bioinformatics Tool for Serpin E1/PAI-1 Antibody (NBP2-13298)

Discover related pathways, diseases and genes to Serpin E1/PAI-1 Antibody (NBP2-13298). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Serpin E1/PAI-1 Antibody (NBP2-13298)

Discover more about diseases related to Serpin E1/PAI-1 Antibody (NBP2-13298).
 

Pathways for Serpin E1/PAI-1 Antibody (NBP2-13298)

View related products by pathway.

PTMs for Serpin E1/PAI-1 Antibody (NBP2-13298)

Learn more about PTMs related to Serpin E1/PAI-1 Antibody (NBP2-13298).

Blogs on Serpin E1/PAI-1

There are no specific blogs for Serpin E1/PAI-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Serpin E1/PAI-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SERPINE1
Entrez