Serpin A6/Cortisol Binding Globulin Antibody

Images

 
Immunohistochemistry-Paraffin: Serpin A6/Cortisol Binding Globulin Antibody [NBP1-88174] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
Immunohistochemistry: Serpin A6/Cortisol Binding Globulin Antibody [NBP1-88174] - Staining of human kidney shows cytoplasmic, membranous and extracellular positivity in cells of renal tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Serpin A6/Cortisol Binding Globulin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TVFFILPDKGKMNTVIAALSRDTINRWSAGLTSSQVDLYIPKVTISGVYDLGDVLEEMGIADLFTNQANFSRITQDAQLKSSKVVHKAVLQLNEEGVDTAGSTGVTLNLTSKPIILRFNQPFIIMIFDHFTWSSLFLARVMN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SERPINA6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Serpin A6/Cortisol Binding Globulin Protein (NBP1-88174PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Serpin A6/Cortisol Binding Globulin Antibody

  • antitrypsin), member 6
  • CBG
  • CBGcorticosteroid-binding globulin
  • corticosteroid binding globulin
  • member 6
  • serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase
  • Serpin A6
  • serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin)
  • transcortin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45825
Species: Hu
Applications: WB, IHC
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-37322
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
7570-GH
Species: Hu
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-35703
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00001325-P01
Species: Hu
NB300-562
Species: Hu, Mu, Rt, Ch, Rb, Sh
Applications: WB, B/N, Flow, ICC/IF, IHC, IHC-P
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-12553
Species: Hu
NBP1-88174
Species: Hu
Applications: IHC, IHC-P

Publications for Serpin A6/Cortisol Binding Globulin Antibody (NBP1-88174) (0)

There are no publications for Serpin A6/Cortisol Binding Globulin Antibody (NBP1-88174).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Serpin A6/Cortisol Binding Globulin Antibody (NBP1-88174) (0)

There are no reviews for Serpin A6/Cortisol Binding Globulin Antibody (NBP1-88174). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Serpin A6/Cortisol Binding Globulin Antibody (NBP1-88174) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Serpin A6/Cortisol Binding Globulin Products

Bioinformatics Tool for Serpin A6/Cortisol Binding Globulin Antibody (NBP1-88174)

Discover related pathways, diseases and genes to Serpin A6/Cortisol Binding Globulin Antibody (NBP1-88174). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Serpin A6/Cortisol Binding Globulin Antibody (NBP1-88174)

Discover more about diseases related to Serpin A6/Cortisol Binding Globulin Antibody (NBP1-88174).
 

Pathways for Serpin A6/Cortisol Binding Globulin Antibody (NBP1-88174)

View related products by pathway.

PTMs for Serpin A6/Cortisol Binding Globulin Antibody (NBP1-88174)

Learn more about PTMs related to Serpin A6/Cortisol Binding Globulin Antibody (NBP1-88174).

Blogs on Serpin A6/Cortisol Binding Globulin

There are no specific blogs for Serpin A6/Cortisol Binding Globulin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Serpin A6/Cortisol Binding Globulin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SERPINA6
Entrez