Serine/threonine-protein kinase NIM1 Antibody

Images

 
Immunohistochemistry-Paraffin: Serine/threonine-protein kinase NIM1 Antibody [NBP2-14254] - Staining of human breast shows distinct cytoplasmic positivity in myoepithelium.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Serine/threonine-protein kinase NIM1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RDSVESGCQTESSKEGEEGQPRQLTPFEKLTQDMSQDEKVVREITLGKRI GFYRIRGEIGSGNFSQVKLGIHSLTKEKVAIKILDKTKLDQKTQRLLSRE ISSMEKLHHPNIIRLYEVVETL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NIM1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Serine/threonine-protein kinase NIM1 Protein (NBP2-14254PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Serine/threonine-protein kinase NIM1 Antibody

  • EC 2.7.11
  • EC 2.7.11.1
  • NIM1
  • serine/threonine-protein kinase NIM1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31333
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NBP2-57758
Species: Hu
Applications: ICC/IF
NBP1-33506
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31541
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-07799
Species: Hu
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP1-33687
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-58345
Species: Hu, Mu, Bv, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-140
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF482
Species: Mu
Applications: WB, IHC
H00005498-M01
Species: Hu
Applications: WB, ELISA, IHC-P, RNAi
NBP2-33735
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14254
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for Serine/threonine-protein kinase NIM1 Antibody (NBP2-14254) (0)

There are no publications for Serine/threonine-protein kinase NIM1 Antibody (NBP2-14254).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Serine/threonine-protein kinase NIM1 Antibody (NBP2-14254) (0)

There are no reviews for Serine/threonine-protein kinase NIM1 Antibody (NBP2-14254). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Serine/threonine-protein kinase NIM1 Antibody (NBP2-14254) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Serine/threonine-protein kinase NIM1 Products

Bioinformatics Tool for Serine/threonine-protein kinase NIM1 Antibody (NBP2-14254)

Discover related pathways, diseases and genes to Serine/threonine-protein kinase NIM1 Antibody (NBP2-14254). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Serine/threonine-protein kinase NIM1 Antibody (NBP2-14254)

Discover more about diseases related to Serine/threonine-protein kinase NIM1 Antibody (NBP2-14254).
 

Pathways for Serine/threonine-protein kinase NIM1 Antibody (NBP2-14254)

View related products by pathway.

PTMs for Serine/threonine-protein kinase NIM1 Antibody (NBP2-14254)

Learn more about PTMs related to Serine/threonine-protein kinase NIM1 Antibody (NBP2-14254).
 

Research Areas for Serine/threonine-protein kinase NIM1 Antibody (NBP2-14254)

Find related products by research area.

Blogs on Serine/threonine-protein kinase NIM1

There are no specific blogs for Serine/threonine-protein kinase NIM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Serine/threonine-protein kinase NIM1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NIM1