CDR1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CDR1 Antibody [NBP2-57758] - Staining of human cell line BJ shows localization to nucleoplasm, the Golgi apparatus & centrosome.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CDR1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SEAMDLREDKDFLEDMDSLEDMALLEDVDLLEDTDFLEDPDFLEAIDLREDKDFLEDMDSLEDLEAIGRCGF
Specificity
Specificity of human CDR1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CDR1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CDR1 Recombinant Protein Antigen (NBP2-57758PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for CDR1 Antibody

  • CDR
  • CDR34
  • CDR62A
  • Cerebellar Degeneration Related Protein 1
  • Cerebellar Degeneration-Related Antigen 1
  • Cerebellar Degeneration-Related Protein (34kD)
  • Cerebellar Degeneration-Related Protein 1, 34kDa
  • Cerebellar Degeneration-Related Protein-1 (34kD)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-10509
Species: Hu, Mu(-)
Applications: WB, ELISA, IHC, IHC-P, IP
NBP1-86613
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34252
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-80073
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NB100-80870
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ELISA, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-13415
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83435
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90226
Species: Hu
Applications: IHC, IHC-P
NBP2-58327
Species: Hu
Applications: WB, ICC/IF
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-42388
Species: Hu
Applications: WB, IHC, IHC-P, KD
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-57758
Species: Hu
Applications: ICC/IF

Publications for CDR1 Antibody (NBP2-57758) (0)

There are no publications for CDR1 Antibody (NBP2-57758).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDR1 Antibody (NBP2-57758) (0)

There are no reviews for CDR1 Antibody (NBP2-57758). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CDR1 Antibody (NBP2-57758) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Array NBP2-57758

Bioinformatics Tool for CDR1 Antibody (NBP2-57758)

Discover related pathways, diseases and genes to CDR1 Antibody (NBP2-57758). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDR1 Antibody (NBP2-57758)

Discover more about diseases related to CDR1 Antibody (NBP2-57758).
 

Pathways for CDR1 Antibody (NBP2-57758)

View related products by pathway.

PTMs for CDR1 Antibody (NBP2-57758)

Learn more about PTMs related to CDR1 Antibody (NBP2-57758).

Blogs on CDR1

There are no specific blogs for CDR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CDR1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDR1