SERAC1 Antibody

Images

 
Western Blot: SERAC1 Antibody [NBP1-82217] - Analysis in human cell line U-251 MG and human cell line MCF-7.
Immunohistochemistry-Paraffin: SERAC1 Antibody [NBP1-82217] - Staining of human gall bladder shows strong membranous and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SERAC1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RVIGNMALNEHLHSSIVRSGWVSIMAEAMKSPHIMESSHAARILANLDRETVQEKYQDGVYVLHPQYRTSQPIKA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SERAC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20-1:50
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SERAC1 Protein (NBP1-82217PEP)
Publications
Read Publication using NBP1-82217.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SERAC1 Antibody

  • FLJ14917
  • FLJ30544
  • protein SERAC1
  • serine active site containing 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85081
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-75531
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-P, WB
DY674
Species: Hu
Applications: ELISA
1129-ER
Species: Hu
Applications: BA
NBP2-38323
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00008878-M01
Species: Bv, Ha, Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB500-201
Species: Ca, Fe, Gp, Ha, Hu, Mu, Rt
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP2-15299
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89396
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF6000
Species: Hu, Mu
Applications: IHC, Simple Western, WB
NBP1-87843
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-77397
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC, IHC-P, KD, Simple Western, WB
MAB2476
Species: Hu
Applications: IHC, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB100-56548
Species: Hu
Applications: ICC/IF, WB
NBP1-92389
Species: Hu
Applications: IHC, IHC-P, WB
NB120-22711
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-38956
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB

Publications for SERAC1 Antibody (NBP1-82217)(1)

Reviews for SERAC1 Antibody (NBP1-82217) (0)

There are no reviews for SERAC1 Antibody (NBP1-82217). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SERAC1 Antibody (NBP1-82217) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SERAC1 Products

Bioinformatics Tool for SERAC1 Antibody (NBP1-82217)

Discover related pathways, diseases and genes to SERAC1 Antibody (NBP1-82217). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SERAC1 Antibody (NBP1-82217)

Discover more about diseases related to SERAC1 Antibody (NBP1-82217).
 

Pathways for SERAC1 Antibody (NBP1-82217)

View related products by pathway.

PTMs for SERAC1 Antibody (NBP1-82217)

Learn more about PTMs related to SERAC1 Antibody (NBP1-82217).
 

Research Areas for SERAC1 Antibody (NBP1-82217)

Find related products by research area.

Blogs on SERAC1

There are no specific blogs for SERAC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SERAC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SERAC1