SENP3 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: SENP3 Antibody [NBP2-32525] - Staining of human cell line MCF7 shows localization to nucleus & nucleoli.

Immunohistochemistry-Paraffin: SENP3 Antibody [NBP2-32525] - Staining of human lateral ventricle shows moderate nucleolar positivity in neuronal cells.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SENP3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SENP3 Antibody - BSA Free (NBP2-32525) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LREEHVTCVQSILDEFLQTYGSLIPLSTDEVVEKLEDIFQQEFSTPSRKGLVLQLIQSYQRMPGNAMVRGFRVAYKRHVLTMDDLGTL
• Predicted Species: Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SENP3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SENP3 Protein (NBP2-32525PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SENP3 Antibody - BSA Free

• DKFZP586K0919
• DKFZp762A152
• EC 3.4.22
• EC 3.4.22.-
• sentrin/SUMO-specific protease 3
• Sentrin/SUMO-specific protease SENP3
• sentrin-specific protease 3
• SMT3IP1
• SSP3DKFZp586K0919
• SUMO1/sentrin/SMT3 specific peptidase 3
• SUMO1/sentrin/SMT3 specific protease 3
• SUMO-1-specific protease 3
• SUSP3

Background

The reversible posttranslational modification of proteins by the addition of small ubiquitin-like SUMO proteins (see SUMO1; MIM 601912) is required for numerous biologic processes. SUMO-specific proteases, such as SENP3, are responsible for the initial processing of SUMO precursors to generate a C-terminal diglycine motif required for the conjugation reaction. They also have isopeptidase activity for the removal of SUMO from high molecular mass SUMO conjugates (Di Bacco et al., 2006 (PubMed 16738315)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SENP3