LAS1L Antibody

Images

 
Western Blot: LAS1L Antibody [NBP2-85201] - Host: Rabbit. Target Name: LAS1L. Sample Type: HT1080. Antibody Dilution: 1.0ug/mlLAS1L is supported by BioGPS gene expression data to be expressed in HT1080
Western Blot: LAS1L Antibody [NBP2-85201] - WB Suggested Anti-LAS1L Antibody Titration: 0.2-1 ug/ml. Positive Control: HepG2 cell lysate
Western Blot: LAS1L Antibody [NBP2-85201] - Host: Rabbit. Target Name: LAS1L. Sample Type: COLO205. Antibody Dilution: 1.0ug/mlLAS1L is supported by BioGPS gene expression data to be expressed in COLO205
Western Blot: LAS1L Antibody [NBP2-85201] - Host: Rabbit. Target Name: LAS1L. Sample Type: MCF7. Antibody Dilution: 1.0ug/mlLAS1L is supported by BioGPS gene expression data to be expressed in MCF7
Western Blot: LAS1L Antibody [NBP2-85201] - Host: Rabbit. Target Name: LAS1L. Sample Type: Hela. Antibody Dilution: 1.0ug/mlLAS1L is supported by BioGPS gene expression data to be expressed in HeLa
Western Blot: LAS1L Antibody [NBP2-85201] - Host: Rabbit. Target Name: LAS1L. Sample Type: OVCAR-3. Antibody Dilution: 1.0ug/mlLAS1L is supported by BioGPS gene expression data to be expressed in OVCAR3

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LAS1L Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human LAS1L. Peptide sequence: SSFGSEAKAQQQEEQGSVNDVKEEEKEEKEVLPDQVEEEEENDDQEEEEE The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
LAS1L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LAS1L Antibody

  • dJ475B7.2
  • FLJ12525
  • FLJ30133
  • FLJ45274
  • LAS1-like (S. cerevisiae)
  • protein LAS1 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-56590
Species: Hu, Rt
Applications: IF, IHC, WB
NB200-331
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP2-30928
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-09260
Species: Hu
Applications: WB
NBP1-88085
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP1-83810
Species: Hu
Applications: IHC, IHC-P
NBP2-94521
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-90457
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-38530
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
DY262
Species: Hu
Applications: ELISA
NBP1-86720
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-30141
Species: Ce, Dr, Hu, In, Ma, Mu, Po, Rt, Ye
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NB300-147
Species: Bv, Ca, Ch, Ha, Hu, Mu(-), Po, Rb, Rt, Xp
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-81535
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-55353
Species: Hu
Applications: ICC/IF

Publications for LAS1L Antibody (NBP2-85201) (0)

There are no publications for LAS1L Antibody (NBP2-85201).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LAS1L Antibody (NBP2-85201) (0)

There are no reviews for LAS1L Antibody (NBP2-85201). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LAS1L Antibody (NBP2-85201) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LAS1L Products

Bioinformatics Tool for LAS1L Antibody (NBP2-85201)

Discover related pathways, diseases and genes to LAS1L Antibody (NBP2-85201). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LAS1L Antibody (NBP2-85201)

Discover more about diseases related to LAS1L Antibody (NBP2-85201).
 

Pathways for LAS1L Antibody (NBP2-85201)

View related products by pathway.

PTMs for LAS1L Antibody (NBP2-85201)

Learn more about PTMs related to LAS1L Antibody (NBP2-85201).

Blogs on LAS1L

There are no specific blogs for LAS1L, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LAS1L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LAS1L