Semaphorin 6B Antibody - BSA Free

Immunohistochemistry-Paraffin: Semaphorin 6B Antibody [NBP2-37950] - Staining of human tonsil shows low expression as expected.

Immunohistochemistry-Paraffin: Semaphorin 6B Antibody [NBP2-37950] - Staining of human cerebral cortex shows high expression.

Immunohistochemistry-Paraffin: Semaphorin 6B Antibody [NBP2-37950] - Staining in human cerebral cortex and tonsil tissues using anti-SEMA6B antibody. Corresponding SEMA6B RNA-seq data are presented for the same tissues.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Semaphorin 6B Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Semaphorin 6B Antibody - BSA Free (NBP2-37950) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: AGTVLKFLVRPNASTSGTSGLSVFLEEFETYRPDRCGRPGGGETGQRLLSLELDAASGGLLAAFPRCVVRVPVARCQQYSGCMKNCIG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SEMA6B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Semaphorin 6B Protein (NBP2-37950PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (87%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Semaphorin 6B Antibody - BSA Free

• sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6B
• Sema6B
• SEMAN
• Semaphorin 6B
• semaphorin VIB
• semaphorin Z
• semaphorin-6B
• semaphorin-6Ba
• SEMA-VIB
• SEMAZ
• SEM-SEMA-Y
• UNQ1907/PRO4353

Background

SEMA6B - sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SEMA6B
• Uniprot:
  • Q9H3T3()