Semaphorin 3A Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Semaphorin 3A Antibody [NBP2-56804] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Semaphorin 3A Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: HGFIQTLLKVTLEVIDTEHLEELLHKDDDGDGSKTKEMSNSMTPSQKVWYRDFMQLINHPNLNTMDEFCEQVWKRDRKQRRQRPGHTPGNSNKWKHL
Specificity
Specificity of human Semaphorin 3A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SEMA3A
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04 - 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Semaphorin 3A Recombinant Protein Antigen (NBP2-56804PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Semaphorin 3A Antibody

  • (semaphorin) 3A
  • coll-1
  • collapsin 1
  • Hsema-I
  • Hsema-III
  • MGC133243
  • sema domain, immunoglobulin domain (Ig), short basic domain, secreted
  • Sema III
  • SEMA1
  • Sema3A
  • SEMAD
  • SEMAIII
  • SEMAL
  • Semaphorin 3A
  • semaphorin D
  • Semaphorin III
  • semaphorin L
  • semaphorin-3A
  • SemD

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF566
Species: Mu, Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready
AF2215
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, IHC, Block, CyTOF-ready
AF4309
Species: Hu, Mu
Applications: WB, IHC, ICC
H00004745-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-91480
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
MAB1728
Species: Hu, Mu
Applications: WB, IHC, ICC
NB100-2218
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-31762
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1146
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
MAB5856
Species: Hu, Mu, Rt
Applications: WB
AF4075
Species: Mu, Rt
Applications: WB, IHC

Publications for Semaphorin 3A Antibody (NBP2-56804) (0)

There are no publications for Semaphorin 3A Antibody (NBP2-56804).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Semaphorin 3A Antibody (NBP2-56804) (0)

There are no reviews for Semaphorin 3A Antibody (NBP2-56804). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Semaphorin 3A Antibody (NBP2-56804) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Semaphorin 3A Products

Bioinformatics Tool for Semaphorin 3A Antibody (NBP2-56804)

Discover related pathways, diseases and genes to Semaphorin 3A Antibody (NBP2-56804). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Semaphorin 3A Antibody (NBP2-56804)

Discover more about diseases related to Semaphorin 3A Antibody (NBP2-56804).
 

Pathways for Semaphorin 3A Antibody (NBP2-56804)

View related products by pathway.

PTMs for Semaphorin 3A Antibody (NBP2-56804)

Learn more about PTMs related to Semaphorin 3A Antibody (NBP2-56804).
 

Research Areas for Semaphorin 3A Antibody (NBP2-56804)

Find related products by research area.

Blogs on Semaphorin 3A

There are no specific blogs for Semaphorin 3A, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Semaphorin 3A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SEMA3A