CRMP2 Antibody

Images

 
Western Blot: CRMP2 Antibody [NBP1-85448] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: CRMP2 Antibody [NBP1-85448] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: CRMP2 Antibody [NBP1-85448] - Staining of human lung shows cytoplasmic and membranous positivity in pneumocytes.
Western Blot: CRMP2 Antibody [NBP1-85448] - Analysis in human cell line U-87 MG.
Immunohistochemistry-Paraffin: CRMP2 Antibody [NBP1-85448] - Staining of human pancreas shows cytoplasmic positivity in islet cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CRMP2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DFFQGTKAALAGGTTMIIDHVVPEPGTSLLAAFDQWREWADSKSCCDYSLHVDISEWHKGIQEEMEALVKDHGVNSFLVYMAFKDRFQLTDCQIYEVLSVIRDIGAIAQVHAENGDIIAEEQQRILDLGITGPEGHVLSR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DPYSL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CRMP2 Protein (NBP1-85448PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CRMP2 Antibody

  • Collapsin response mediator protein 2
  • CRMP-2
  • CRMP2N2A3
  • DHPRP2
  • dihydropyrimidinase-like 2 long form
  • dihydropyrimidinase-like 2
  • dihydropyrimidinase-related protein 2
  • DRP2collapsin response mediator protein hCRMP-2
  • DRP-2ULIP-2
  • ULIP2
  • Unc-33-like phosphoprotein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85447
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00007402-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-15843
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76652
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-33419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47470
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NBP2-25147
Species: Hu, Mu, Rt, Bv, Xp
Applications: WB, Simple Western, ICC/IF
NBP2-13913
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13937
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-155
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-02477
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-91744
Species: Hu
Applications: IHC, IHC-P
NBP1-85224
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CRMP2 Antibody (NBP1-85448) (0)

There are no publications for CRMP2 Antibody (NBP1-85448).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CRMP2 Antibody (NBP1-85448) (0)

There are no reviews for CRMP2 Antibody (NBP1-85448). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CRMP2 Antibody (NBP1-85448) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CRMP2 Products

CRMP2 NBP1-85448

Bioinformatics Tool for CRMP2 Antibody (NBP1-85448)

Discover related pathways, diseases and genes to CRMP2 Antibody (NBP1-85448). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CRMP2 Antibody (NBP1-85448)

Discover more about diseases related to CRMP2 Antibody (NBP1-85448).
 

Pathways for CRMP2 Antibody (NBP1-85448)

View related products by pathway.

PTMs for CRMP2 Antibody (NBP1-85448)

Learn more about PTMs related to CRMP2 Antibody (NBP1-85448).
 

Research Areas for CRMP2 Antibody (NBP1-85448)

Find related products by research area.

Blogs on CRMP2

There are no specific blogs for CRMP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CRMP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DPYSL2