CRMP2 Antibody

Western Blot: CRMP2 Antibody [NBP1-85448] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunocytochemistry/Immunofluorescence: CRMP2 Antibody [NBP1-85448] - Staining of human cell line U-2 OS shows localization to plasma membrane & cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: CRMP2 Antibody [NBP1-85448] - Staining of human lung shows cytoplasmic and membranous positivity in pneumocytes.

Western Blot: CRMP2 Antibody [NBP1-85448] - Analysis in human cell line U-87 MG.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

CRMP2 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DFFQGTKAALAGGTTMIIDHVVPEPGTSLLAAFDQWREWADSKSCCDYSLHVDISEWHKGIQEEMEALVKDHGVNSFLVYMAFKDRFQLTDCQIYEVLSVIRDIGAIAQVHAENGDIIAEEQQRILDLGITGPEGHVLSR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DPYSL2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25 - 2 ug/mL
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04 - 0.4 ug/mL
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CRMP2 Protein (NBP1-85448PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CRMP2 Antibody

• Collapsin response mediator protein 2
• CRMP-2
• CRMP2N2A3
• DHPRP2
• dihydropyrimidinase-like 2 long form
• dihydropyrimidinase-like 2
• dihydropyrimidinase-related protein 2
• DRP2collapsin response mediator protein hCRMP-2
• DRP-2ULIP-2
• ULIP2
• Unc-33-like phosphoprotein 2

Background

Collapsin response mediator proteins (CRMPs) are cytosolic phosphoproteins involved in neuronal differentiation and axonal guidance. CRMP2 was previously shown to mediate the repulsive effect of Sema3A on axons and to participate in axonal specification. The CRMPs appear to play a complex role in axon growth as well as microtubule dynamics and axon induction. CRMPs localize to the lamellipodia and filopodia of axonal growth cones, suggesting a role in axon guidance. Moreover, CRMP2 is upregulated after axotomy, and appears to increase the formation of axon-type processes from hippocampal neurons. CRMP2 has been reported to bind tubulin dimers directly and modulate microtubule assembly. CRMPs have also been implicated in the pathogenesis of a paraneoplastic neurologic syndrome. Interaction studies have implicated phospholipase D2 (PLD2), the cytosolic tyrosine kinase Fes, and intersectin in CRMP function. Hyperphosphorylation of CRMP2 is an early event in the progression of Alzheimer's disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Reviews for CRMP2 Antibody (NBP1-85448) (2)

Average Rating: 3

(Based on 2 reviews)

We have 2 reviews tested in 1 species: Rat.

reviewed by: Lucia Lisi ICC Rat 05/21/2021

Summary

• Application: Immunocytochemistry
• Sample Tested: microglia
• Species: Rat
• Lot: AS2695

reviewed by: Lucia Lisi WB Rat 05/20/2021

Summary

• Application: Western Blot
• Sample Tested: Human microglia cell lysate,MICROGLIA
• Species: Rat
• Lot: AS2695

Comments

• Comments: ***Bio-Techne Response: Thank you for reviewing our product. We are sorry to that that this product did not perform as expected. We have been in touch with the customer to resolve this issue according to our Product Guarantee and to the customer’s satisfaction.***

Bioinformatics

• Gene Symbol: DPYSL2