SEMA3D Antibody

Images

 
Immunohistochemistry-Paraffin: SEMA3D Antibody [NBP1-85517] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SEMA3D Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LYSGTASDFLGKDTAFTRSLGPTHDHHYIRTDISEHYWLNGAKFIGTFFIPDTYNPDDDKIYFFFRESSQEGSTSDKTILSRVGRVCKNDVG
Predicted Species
Mouse (91%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SEMA3D
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
IHC reported in scientific literature (PMID: 28320475). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SEMA3D Protein (NBP1-85517PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-85517 in the following applications:

Publications
Read Publications using
NBP1-85517 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SEMA3D Antibody

  • (semaphorin) 3D
  • coll-2
  • Collapsin 2
  • MGC39708
  • sema domain, immunoglobulin domain (Ig), short basic domain, secreted
  • SEMA3D
  • Semaphorin 3D
  • Semaphorin-3D
  • Sema-Z2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

1250-S3
Species: Hu
Applications: BA, BA
AF566
Species: Mu, Rt
Applications: Block, CyTOF-ready, Flow, IHC, WB
AF3239
Species: Hu, Mu
Applications: ICC, IHC, WB
AF2215
Species: Hu, Mu, Rt
Applications: Block, CyTOF-ready, Flow, IHC, Simple Western, WB
NB100-2218
Species: Bv, Ca, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
3237-S3
Species: Mu
Applications: BA
NBP1-83881
Species: Hu
Applications: IHC, IHC-P
DVE00
Species: Hu
Applications: ELISA
NBP1-85447
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB1728
Species: Hu, Mu
Applications: ICC, IHC, WB
NBP1-76899
Species: Hu, Mu, Rt
Applications: ELISA, IF, IHC, IHC-P, WB
NBP2-30876
Species: Hu
Applications: IHC, IHC-P
NBP1-59140
Species: Hu
Applications: WB
NBP2-67667
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-20486
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
8616-SL
Species: Hu
Applications: BA
AF5486
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, Simple Western, WB
AF1837
Species: Hu
Applications: ICC, IHC, Simple Western, WB

Publications for SEMA3D Antibody (NBP1-85517)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IHC, IHC-P.


Filter By Application
IHC
(1)
IHC-P
(1)
All Applications
Filter By Species
Human
(2)
All Species

Review for SEMA3D Antibody (NBP1-85517) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP1-85517:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot SEMA3D NBP1-85517
Enlarge
5
reviewed by:
Verified Customer
WB Mouse 11/01/2016
View

Summary

ApplicationWestern Blot
Sample TestedAdult mouse brain tissue
SpeciesMouse

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SEMA3D Antibody (NBP1-85517) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SEMA3D Products

Bioinformatics Tool for SEMA3D Antibody (NBP1-85517)

Discover related pathways, diseases and genes to SEMA3D Antibody (NBP1-85517). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SEMA3D Antibody (NBP1-85517)

Discover more about diseases related to SEMA3D Antibody (NBP1-85517).
 

Pathways for SEMA3D Antibody (NBP1-85517)

View related products by pathway.

PTMs for SEMA3D Antibody (NBP1-85517)

Learn more about PTMs related to SEMA3D Antibody (NBP1-85517).
 

Research Areas for SEMA3D Antibody (NBP1-85517)

Find related products by research area.

Blogs on SEMA3D

There are no specific blogs for SEMA3D, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Verified Customer
11/01/2016
Application: WB
Species: Mouse

Bioinformatics

Gene Symbol SEMA3D