CRMP4 Antibody

Images

 
Western Blot: CRMP4 Antibody [NBP1-85447] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
Immunocytochemistry/ Immunofluorescence: CRMP4 Antibody [NBP1-85447] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemistry-Paraffin: CRMP4 Antibody [NBP1-85447] - Staining of human smooth muscle shows cytoplasmic positivity in smooth muscle cells.
Western Blot: CRMP4 Antibody [NBP1-85447] - Analysis in human cell line NTERA-2.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CRMP4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IIDHVVPEPESSLTEAYEKWREWADGKSCCDYALHVDITHWNDSVKQEVQNLIKDKGVNSFMVYMAYKDLYQVSNTELYEIFTCLGELGAIAQVHAENGDIIAQEQTRMLEMGITGPE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DPYSL3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CRMP4 Protein (NBP1-85447PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CRMP4 Antibody

  • Collapsin response mediator protein 4
  • CRMP-4
  • CRMP4collapsin response mediator protein 4 long
  • dihydropyrimidinase-like 3
  • DRP-3dihydropyrimidinase-related protein 3
  • DRP3ULIP1
  • ULIP-1
  • ULIPLCRMP
  • Unc-33-like phosphoprotein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85448
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13937
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76652
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-85224
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP2-15843
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00007402-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-13913
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02149
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB120-11220
Species: Hu, Mu, Rt, Ma
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr
NB100-61071
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-86525
Species: Hu
Applications: IHC, IHC-P
NBP1-85447
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CRMP4 Antibody (NBP1-85447) (0)

There are no publications for CRMP4 Antibody (NBP1-85447).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CRMP4 Antibody (NBP1-85447) (0)

There are no reviews for CRMP4 Antibody (NBP1-85447). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CRMP4 Antibody (NBP1-85447) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CRMP4 Products

Bioinformatics Tool for CRMP4 Antibody (NBP1-85447)

Discover related pathways, diseases and genes to CRMP4 Antibody (NBP1-85447). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CRMP4 Antibody (NBP1-85447)

Discover more about diseases related to CRMP4 Antibody (NBP1-85447).
 

Pathways for CRMP4 Antibody (NBP1-85447)

View related products by pathway.

PTMs for CRMP4 Antibody (NBP1-85447)

Learn more about PTMs related to CRMP4 Antibody (NBP1-85447).
 

Research Areas for CRMP4 Antibody (NBP1-85447)

Find related products by research area.

Blogs on CRMP4

There are no specific blogs for CRMP4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CRMP4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DPYSL3