SEMA3G Antibody

Images

 
Immunohistochemistry-Paraffin: SEMA3G Antibody [NBP1-83881] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells and islet cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SEMA3G Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VRWLLQRPGDEGPDQVKTDERVLHTERGLLFRRLSRFDAGTYTCTTLEHGFSQTVVRLALVVIVASQLDNLFPPEPKPEEPPARGGLASTPPKAWYKDILQLIG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SEMA3G
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SEMA3G Protein (NBP1-83881PEP)
Publications
Read Publication using NBP1-83881.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SEMA3G Antibody

  • (semaphorin) 3G
  • FLJ00014
  • MGC119473
  • sem2
  • sema domain, immunoglobulin domain (Ig), short basic domain, secreted
  • SEMA3G
  • Semaphorin 3G
  • Semaphorin sem2
  • Semaphorin-3G

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2218
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF567
Species: Mu, Rt
Applications: WB, Simple Western, IHC, Block
AF566
Species: Mu, Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready
NBP1-85517
Species: Hu
Applications: IHC, IHC-P
NBP1-84408
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-76899
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-81162
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
7707-NP
Species: Hu
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
AF7109
Species: Mu
Applications: WB, IHC
NBP2-25198
Species: Hu
Applications: Flow, IP, Flow-CS
AF4160
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
MAB1728
Species: Hu, Mu
Applications: WB, IHC, ICC

Publications for SEMA3G Antibody (NBP1-83881)(1)

Reviews for SEMA3G Antibody (NBP1-83881) (0)

There are no reviews for SEMA3G Antibody (NBP1-83881). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SEMA3G Antibody (NBP1-83881) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SEMA3G Products

Bioinformatics Tool for SEMA3G Antibody (NBP1-83881)

Discover related pathways, diseases and genes to SEMA3G Antibody (NBP1-83881). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SEMA3G Antibody (NBP1-83881)

Discover more about diseases related to SEMA3G Antibody (NBP1-83881).
 

Pathways for SEMA3G Antibody (NBP1-83881)

View related products by pathway.

Blogs on SEMA3G

There are no specific blogs for SEMA3G, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SEMA3G Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SEMA3G
Entrez