SELS Antibody

Images

 
Genetic Strategies: Western Blot: SELS Antibody [NBP1-89558] - Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-SELENOS antibody. Remaining relative ...read more
Immunocytochemistry/ Immunofluorescence: SELS Antibody [NBP1-89558] - Immunofluorescent staining of human cell line U-251 MG shows localization to endoplasmic reticulum.
Immunohistochemistry-Paraffin: SELS Antibody [NBP1-89558] - Staining of human tonsil shows strong cytoplasmic positivity in a small subset of germinal center cells.
Western Blot: SELS Antibody [NBP1-89558] - Analysis in human cell line HEK 293.
Western Blot: SELS Antibody [NBP1-89558] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: SELS Antibody [NBP1-89558] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: SELS Antibody [NBP1-89558] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: SELS Antibody [NBP1-89558] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

SELS Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDSMQEGKSYKGNAKKPQEEDSPGPSTSSVLKRKSDRKPLRGGGYNPLSGEGGGACSWRPGR
Specificity
Specificity of human, mouse, rat SELS antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VIMP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04 - 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SELS Protein (NBP1-89558PEP)
Publications
Read Publications using
NBP1-89558 in the following applications:

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23614019)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SELS Antibody

  • ADO15
  • MGC104346
  • SBBI8
  • selenoprotein S
  • SelS
  • SEPS1
  • VCP-interacting membrane protein
  • VIMPMGC2553

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-448
Species: Hu, Mu, Ca, ChHa
Applications: WB, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-91629
Species: Hu
Applications: WB
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-94035
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-76544
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
NB100-1558
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
AF3798
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, KO
NBP1-80766
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-06274
Species: Hu, Mu, Rt, Ce, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IHC-FrFl
NB600-1287
Species: Hu, Mu, Rt, Rb
Applications: WB, Flow, IHC, IP, CyTOF-ready
NBP2-33648
Species: Hu
Applications: IHC, IHC-P

Publications for SELS Antibody (NBP1-89558)(3)

Reviews for SELS Antibody (NBP1-89558) (0)

There are no reviews for SELS Antibody (NBP1-89558). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SELS Antibody (NBP1-89558) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SELS Products

Bioinformatics Tool for SELS Antibody (NBP1-89558)

Discover related pathways, diseases and genes to SELS Antibody (NBP1-89558). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SELS Antibody (NBP1-89558)

Discover more about diseases related to SELS Antibody (NBP1-89558).
 

Pathways for SELS Antibody (NBP1-89558)

View related products by pathway.

PTMs for SELS Antibody (NBP1-89558)

Learn more about PTMs related to SELS Antibody (NBP1-89558).
 

Research Areas for SELS Antibody (NBP1-89558)

Find related products by research area.

Blogs on SELS

There are no specific blogs for SELS, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SELS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol VIMP