SELS Antibody - BSA Free

Staining of human cell line U-251 MG shows localization to endoplasmic reticulum.

Immunohistochemistry-Paraffin: SELS Antibody [NBP1-89558] - Staining of human tonsil shows strong cytoplasmic positivity in a small subset of germinal center cells.

Immunohistochemistry-Paraffin: SELS Antibody [NBP1-89558] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Immunohistochemistry-Paraffin: SELS Antibody [NBP1-89558] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: SELS Antibody [NBP1-89558] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-SELENOS antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Analysis in human cell line HEK 293.

• Reactivity: Hu
• Applications: WB, Simple Western, ICC/IF, IHC, Mycoplasma
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SELS Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SELS Antibody - BSA Free (NBP1-89558) is a polyclonal antibody validated for use in IHC, WB, ICC/IF and Simple Western. Anti-SELS Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDSMQEGKSYKGNAKKPQEEDSPGPSTSSVLKRKSDRKPLRGGGYNPLSGEGGGACSWRPGR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: VIMP
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
  • Simple Western
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SELS Protein (NBP1-89558PEP)

Reactivity Notes

Mouse, Rat (86%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SELS Antibody - BSA Free

• ADO15
• MGC104346
• SBBI8
• selenoprotein S
• SelS
• SEPS1
• VCP-interacting membrane protein
• VIMPMGC2553

Background

SELS encodes a selenoprotein, which contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon that normally signals translation termination. The 3' UTR of selenoprotein genes have a common stem-loop structure, the sec insertion sequence (SECIS), that is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. Studies suggest that this protein may regulate cytokine production, and thus play a key role in the control of the inflammatory response. Two alternatively spliced transcript variants encoding the same protein have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SELS Antibody (NBP1-89558)(3)

Publications using NBP1-89558

• Touat-Hamici Z, Legrain Y, Bulteau AL et al. Selective Up-regulation of Human Selenoproteins in Response to Oxidative Stress. J Biol Chem 2014-05-23 [PMID: 24706762] (WB, Human)
• Bubenik JL, Miniard AC, Driscoll DM. Alternative Transcripts and 3UTR Elements Govern the Incorporation of Selenocysteine into Selenoprotein S. PLoS One 2013-01-01 [PMID: 23614019] (ICC/IF, WB)
• Paavilainen L, Edvinsson A, Asplund A et al. The impact of tissue fixatives on morphology and antibody-based protein profiling in tissues and cells. J Histochem Cytochem 2010-03-01 [PMID: 19901271]

Bioinformatics

• Gene Symbol: VIMP