Immunocytochemistry/ Immunofluorescence: SEC16A Antibody [NBP1-83016] - Staining of human cell line A-431 shows localization to endoplasmic reticulum & the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SEC16A Antibody [NBP1-83016] - Staining of human skin shows strong cytoplasmic granular positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: SEC16A Antibody [NBP1-83016] - Staining of human pancreas shows strong cytoplasmic granular positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: SEC16A Antibody [NBP1-83016] - Staining of human placenta shows strong cytoplasmic granular positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: SEC16A Antibody [NBP1-83016] - Staining of human prostate shows strong cytoplasmic granular positivity in glandular cells.
Orthogonal Strategies: Western Blot: SEC16A Antibody [NBP1-83016] -Analysis in human cell lines MCF-7 and SK-MEL-30 using Anti-SEC16A antibody. Corresponding SEC16A RNA-seq data are presented for the same cell ...read more
Novus Biologicals Rabbit SEC16A Antibody - BSA Free (NBP1-83016) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-SEC16A Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PLPIPSNLFVPTPDAEEPQLPDGTGREGPAAARGLANPEPAPEPKAPGDLPAAGGPPSGAMPFYNPAQ
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SEC16A
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for SEC16A Antibody - BSA Free
FLJ26737
KIAA0310RP11-413M3.10
p250protein SEC16 homolog A
SEC16 homolog A (S. cerevisiae)
SEC16 homolog A
SEC16
SEC16Lprotein transport protein Sec16A
Background
SEC16A is required for secretory cargo traffic from the endoplasmic reticulum to the Golgi apparatus. It defines endoplasmic reticulum exit sites (ERES). SAR1A-GTP-dependent assembly of SEC16A on the ER membrane forms an organized scaffold defining an ERES. It is required for normal transitional endoplasmic reticulum (tER) organization.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our SEC16A Antibody - BSA Free and receive a gift card or discount.