![Immunocytochemistry/Immunofluorescence: SEC16A Antibody [NBP1-83016] - Staining of human cell line A-431 shows localization to endoplasmic reticulum & the Golgi apparatus. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/SEC16A-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83016-img0005.jpg "Immunocytochemistry/Immunofluorescence: SEC16A Antibody [NBP1-83016] - Staining of human cell line A-431 shows localization to endoplasmic reticulum & the Golgi apparatus. Antibody staining is shown in green.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PLPIPSNLFVPTPDAEEPQLPDGTGREGPAAARGLANPEPAPEPKAPGDLPAAGGPPSGAMPFYNPAQ |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SEC16A |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SEC16A |
![Immunohistochemistry-Paraffin: SEC16A Antibody [NBP1-83016] - Staining of human skin shows strong cytoplasmic granular positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/SEC16A-Antibody-Immunohistochemistry-Paraffin-NBP1-83016-img0009.jpg "Immunohistochemistry-Paraffin: SEC16A Antibody [NBP1-83016] - Staining of human skin shows strong cytoplasmic granular positivity in squamous epithelial cells.")
![Immunohistochemistry-Paraffin: SEC16A Antibody [NBP1-83016] - Staining of human pancreas shows strong cytoplasmic granular positivity in exocrine glandular cells.](http://images.novusbio.com/fullsize/SEC16A-Antibody-Immunohistochemistry-Paraffin-NBP1-83016-img0006.jpg "Immunohistochemistry-Paraffin: SEC16A Antibody [NBP1-83016] - Staining of human pancreas shows strong cytoplasmic granular positivity in exocrine glandular cells.")
![Immunohistochemistry-Paraffin: SEC16A Antibody [NBP1-83016] - Staining of human placenta shows strong cytoplasmic granular positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/SEC16A-Antibody-Immunohistochemistry-Paraffin-NBP1-83016-img0007.jpg "Immunohistochemistry-Paraffin: SEC16A Antibody [NBP1-83016] - Staining of human placenta shows strong cytoplasmic granular positivity in trophoblastic cells.")
![Immunohistochemistry-Paraffin: SEC16A Antibody [NBP1-83016] - Staining of human prostate shows strong cytoplasmic granular positivity in glandular cells.](http://images.novusbio.com/fullsize/SEC16A-Antibody-Immunohistochemistry-Paraffin-NBP1-83016-img0008.jpg "Immunohistochemistry-Paraffin: SEC16A Antibody [NBP1-83016] - Staining of human prostate shows strong cytoplasmic granular positivity in glandular cells.")
![Western Blot: SEC16A Antibody [NBP1-83016] -Analysis in human cell lines MCF-7 and SK-MEL-30 using Anti-SEC16A antibody. Corresponding SEC16A RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.](http://images.novusbio.com/fullsize/antibody/nbp1-83016_rabbit-polyclonal-sec16a-antibody-western-blot-1510202481955..jpg "Western Blot: SEC16A Antibody [NBP1-83016] -Analysis in human cell lines MCF-7 and SK-MEL-30 using Anti-SEC16A antibody. Corresponding SEC16A RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.")
![Western Blot c-Abl Antibody [Unconjugated]](https://images.novusbio.com/images2/c-Abl_AF5414_Western_Blot_5714.jpg)
![Simple Western c-Abl Antibody [Unconjugated]](https://images.novusbio.com/images2/cAbl_AF5414_Simple_Western_17046.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")