SEC16A Antibody


Immunocytochemistry/ Immunofluorescence: SEC16A Antibody [NBP1-83016] - Staining of human cell line A-431 shows localization to endoplasmic reticulum & the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SEC16A Antibody [NBP1-83016] - Staining of human skin shows moderate cytoplasmic positivity in keratinocytes.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

SEC16A Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: PLPIPSNLFVPTPDAEEPQLPDGTGREGPAAARGLANPEPAPEPKAPGDLPAAGGPPSGAMPFYNPAQ
Specificity of human SEC16A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in Western blot reported in scientific literature (PMID 28710282).
Positive Control
SEC16A Lysate (NBP2-66148)
Control Peptide
SEC16A Protein (NBP1-83016PEP)
Read Publication using
NBP1-83016 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for SEC16A Antibody

  • FLJ26737
  • KIAA0310RP11-413M3.10
  • p250protein SEC16 homolog A
  • SEC16 homolog A (S. cerevisiae)
  • SEC16 homolog A
  • SEC16
  • SEC16Lprotein transport protein Sec16A


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC-P, IP, PLA
Species: Hu
Applications: WB, IHC, IHC-P, KD
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Ma
Applications: WB, Simple Western, Flow, ICC/IF, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
Species: Hu
Species: Hu
Applications: WB, Simple Western
Species: Hu
Applications: ICC/IF
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SEC16A Antibody (NBP1-83016)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for SEC16A Antibody (NBP1-83016) (0)

There are no reviews for SEC16A Antibody (NBP1-83016). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SEC16A Antibody (NBP1-83016) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional SEC16A Products

Bioinformatics Tool for SEC16A Antibody (NBP1-83016)

Discover related pathways, diseases and genes to SEC16A Antibody (NBP1-83016). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SEC16A Antibody (NBP1-83016)

Discover more about diseases related to SEC16A Antibody (NBP1-83016).

Pathways for SEC16A Antibody (NBP1-83016)

View related products by pathway.

Blogs on SEC16A

There are no specific blogs for SEC16A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SEC16A Antibody and receive a gift card or discount.


Gene Symbol SEC16A