SEC16A Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SEC16A Antibody [NBP1-83016] - Staining of human cell line A-431 shows localization to endoplasmic reticulum & the Golgi apparatus.
Immunohistochemistry-Paraffin: SEC16A Antibody [NBP1-83016] - Staining of human skin shows moderate cytoplasmic positivity in keratinocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SEC16A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PLPIPSNLFVPTPDAEEPQLPDGTGREGPAAARGLANPEPAPEPKAPGDLPAAGGPPSGAMPFYNPAQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SEC16A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in Western blot reported in scientific literature (PMID 28710282).
Control Peptide
SEC16A Protein (NBP1-83016PEP)
Publications
Read Publication using
NBP1-83016 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SEC16A Antibody

  • FLJ26737
  • KIAA0310RP11-413M3.10
  • p250protein SEC16 homolog A
  • SEC16 homolog A (S. cerevisiae)
  • SEC16 homolog A
  • SEC16
  • SEC16Lprotein transport protein Sec16A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-06529
Species: Hu
Applications: WB, IHC-P, IP, PLA
NBP1-80789
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF5557
Species: Hu
Applications: WB
NBP1-92093
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB90551
Species: Hu, Mu, Rt
Applications: WB
NBP2-13943
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-01264
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-74648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-85841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-179
Species: Hu, Mu, Rt, Po, Ma
Applications: WB, Simple Western, Flow, ICC/IF, IP
NBP1-88815
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82456
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
H00027044-R01
Species: Hu
AF5414
Species: Hu
Applications: WB, Simple Western
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP1-59448
Species: Hu
Applications: WB
NBP1-83016
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SEC16A Antibody (NBP1-83016)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for SEC16A Antibody (NBP1-83016) (0)

There are no reviews for SEC16A Antibody (NBP1-83016). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SEC16A Antibody (NBP1-83016) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SEC16A Products

SEC16A NBP1-83016

Bioinformatics Tool for SEC16A Antibody (NBP1-83016)

Discover related pathways, diseases and genes to SEC16A Antibody (NBP1-83016). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SEC16A Antibody (NBP1-83016)

Discover more about diseases related to SEC16A Antibody (NBP1-83016).
 

Pathways for SEC16A Antibody (NBP1-83016)

View related products by pathway.

Blogs on SEC16A

There are no specific blogs for SEC16A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SEC16A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SEC16A