SCP2/SYCP2 Antibody


Immunocytochemistry/ Immunofluorescence: SCP2 Antibody [NBP2-55940] - Staining of human cell line CACO-2 shows localization to nucleoplasm & plasma membrane.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF

Order Details

SCP2/SYCP2 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TTFVNVTSECPVNDVYNFNLNGADDPIIKLGIQEFQATAKEACADRSIRLVGPRNHDELKSSVKTKDKKIITNHQKKNLFSDTETEYRCDDSKTDISW
Specificity of human SCP2/SYCP2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SCP2/SYCP2 Recombinant Protein Antigen (NBP2-55940PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, pH 7.2, containing 40% glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for SCP2/SYCP2 Antibody

  • NLTP
  • non-specific lipid-transfer protein
  • NSL-TP
  • Propanoyl-CoA C-acyltransferase
  • SCP-2
  • SCPX
  • SCP-X
  • Sterol Carrier Protein 2
  • Sterol carrier protein X


Chimera RNA interference (chimera RNAi) is process by which small interfering RNA/DNA chimera triggers the destruction of mRNA for the original gene. The discovery work, design, and application of chimera RNAi has been pioneered by Professor Kaoru Saigo and Dr. Kumiko Ui-Tei at the University of Tokyo. Chimera RNAi has many advantages over the conventional siRNAs. First, it has been demonstrated to have reliable knock-down for over 10,000 human genes. Because the human genome is composed of an intricate, genetic network, chimera RNAi's unique design has successfully obviated the off-target effects including microRNA-based influence. Another advantage of the chimera RNAi technology is its effectiveness at low concentrations (0.5nM to 5nM); only mRNA is destroyed so genomic genes are not affected. Finally, having both the sense and anti-sense strands consisting RNA/DNA chimera, it offers much greater compound stability for streamlining in vitro and in vivo assays and applications while minimizing interferon induction and other adverse reactions.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Po, Bv, Ch, Fe, Pa
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu, Rt, Ma, Pa, Hu(-)
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF

Publications for SCP2/SYCP2 Antibody (NBP2-55940) (0)

There are no publications for SCP2/SYCP2 Antibody (NBP2-55940).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCP2/SYCP2 Antibody (NBP2-55940) (0)

There are no reviews for SCP2/SYCP2 Antibody (NBP2-55940). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SCP2/SYCP2 Antibody (NBP2-55940) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for SCP2/SYCP2 Antibody (NBP2-55940)

Discover related pathways, diseases and genes to SCP2/SYCP2 Antibody (NBP2-55940). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SCP2/SYCP2 Antibody (NBP2-55940)

Discover more about diseases related to SCP2/SYCP2 Antibody (NBP2-55940).

Pathways for SCP2/SYCP2 Antibody (NBP2-55940)

View related products by pathway.

PTMs for SCP2/SYCP2 Antibody (NBP2-55940)

Learn more about PTMs related to SCP2/SYCP2 Antibody (NBP2-55940).

Blogs on SCP2/SYCP2

There are no specific blogs for SCP2/SYCP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SCP2/SYCP2 Antibody and receive a gift card or discount.


Gene Symbol SYCP2