SAT1 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: RLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLV |
| Predicted Species |
Mouse (95%), Rat (95%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
SAT1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for SAT1 Antibody - BSA Free
Background
SAT1--also known as Spermidine/spermine-N1-acetyltransferase (SSAT1)--is a short-lived polyamine catabolic enzyme which catalyzes the acetylation of spermidine and spermine. SAT1 is a highly regulated enzyme which allows a fine attenuation of the intracellular concentration of polyamines. Induction of SAT1 plays an important role in polyamine homoeostasis, since the N1-acetylated polyamines can be excreted or oxidized by acetylpolyamine oxidase.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, WB
Species: Bt, Bv, Ca, Eq, Ha, Hu, Pm, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC
Publications for SAT1 Antibody (NBP2-37947) (0)
There are no publications for SAT1 Antibody (NBP2-37947).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SAT1 Antibody (NBP2-37947) (0)
There are no reviews for SAT1 Antibody (NBP2-37947).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for SAT1 Antibody (NBP2-37947). (Showing 1 - 1 of 1 FAQ).
-
I need to radiolabel (iodinate) the SAT1 antibody. Which one should I use?
- I would recommend NB110-41622 for you as it is a well validated antibody with very clean QC validation data, multiple applications/broad species reactivity. Additionally, this antibody has been cited by Liao et al. in The Journal of Biological Chemistry 2009;284(12):8174-8184 (https://www.jbc.org/article/S0021-9258(20)32529-1/fulltext).
Secondary Antibodies
| |
Isotype Controls
|
Additional SAT1 Products
Research Areas for SAT1 Antibody (NBP2-37947)
Find related products by research area.
|
Blogs on SAT1