SAT1 Antibody - BSA Free

Immunohistochemistry-Paraffin: SAT1 Antibody [NBP2-37947] - Staining of human upper gastrointestinal shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: SAT1 Antibody [NBP2-37947] - Staining of human testis shows distinct cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: SAT1 Antibody [NBP2-37947] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: SAT1 Antibody [NBP2-37947] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: SAT1 Antibody [NBP2-37947] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SAT1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SAT1 Antibody - BSA Free (NBP2-37947) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLV
• Predicted Species: Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SAT1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SAT1 Protein (NBP2-37947PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SAT1 Antibody - BSA Free

• DC21
• diamine acetyltransferase 1
• diamine N-acetyltransferase 1
• EC 2.3.1.57
• KFSD
• Polyamine N-acetyltransferase 1
• Putrescine acetyltransferase
• SAT
• Spermidine/spermine N(1)-acetyltransferase 1
• spermidine/spermine N1-acetyltransferase 1
• spermidine/spermine N1-acetyltransferase alpha
• spermidine/spermine N1-acetyltransferase
• SSAT-1
• SSATKFSDX

Background

SAT1--also known as Spermidine/spermine-N1-acetyltransferase (SSAT1)--is a short-lived polyamine catabolic enzyme which catalyzes the acetylation of spermidine and spermine. SAT1 is a highly regulated enzyme which allows a fine attenuation of the intracellular concentration of polyamines. Induction of SAT1 plays an important role in polyamine homoeostasis, since the N1-acetylated polyamines can be excreted or oxidized by acetylpolyamine oxidase.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for SAT1 Antibody (NBP2-37947). (Showing 1 - 1 of 1 FAQ).

1. I need to radiolabel (iodinate) the SAT1 antibody. Which one should I use?
   • I would recommend NB110-41622 for you as it is a well validated antibody with very clean QC validation data, multiple applications/broad species reactivity. Additionally, this antibody has been cited by Liao et al. in The Journal of Biological Chemistry 2009;284(12):8174-8184 (https://www.jbc.org/article/S0021-9258(20)32529-1/fulltext).

Bioinformatics

• Gene Symbol: SAT1
• Uniprot:
  • P21673(Human)