SASH1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SASH1 Antibody [NBP1-85183] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli and cytoplasm.
Immunohistochemistry-Paraffin: SASH1 Antibody [NBP1-85183] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.
Immunocytochemistry/ Immunofluorescence: SASH1 Antibody [NBP1-85183] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SASH1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LLSAKSSTEPSLKSFSRNQLGNYPTLPLMKSGDALKQGQEEGRLGGGLAPDTSKSCDPPGVTGLNKNRRSLPVSICRSCETLEGPQTVDTWPRSH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SASH1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SASH1 Protein (NBP1-85183PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SASH1 Antibody

  • dJ323M4
  • dJ323M4.1
  • KIAA0790RP3-323M4.1
  • PEPE1
  • Proline-glutamate repeat-containing protein
  • SAM and SH3 domain containing 1,2500002E12Rik
  • SAM and SH3 domain-containing protein 1
  • SH3D6A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-78295
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-92158
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NBP1-89830
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83915
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-193
Species: Hu, Mu, Rt, Ch, GP
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-00555
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF6347
Species: Hu
Applications: WB
NBP1-89631
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-89942
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-15971
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP1-89352
Species: Hu
Applications: Simple Western, IHC, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-85183
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for SASH1 Antibody (NBP1-85183) (0)

There are no publications for SASH1 Antibody (NBP1-85183).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SASH1 Antibody (NBP1-85183) (0)

There are no reviews for SASH1 Antibody (NBP1-85183). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SASH1 Antibody (NBP1-85183) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SASH1 Products

Bioinformatics Tool for SASH1 Antibody (NBP1-85183)

Discover related pathways, diseases and genes to SASH1 Antibody (NBP1-85183). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SASH1 Antibody (NBP1-85183)

Discover more about diseases related to SASH1 Antibody (NBP1-85183).
 

Pathways for SASH1 Antibody (NBP1-85183)

View related products by pathway.

PTMs for SASH1 Antibody (NBP1-85183)

Learn more about PTMs related to SASH1 Antibody (NBP1-85183).
 

Research Areas for SASH1 Antibody (NBP1-85183)

Find related products by research area.

Blogs on SASH1

There are no specific blogs for SASH1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SASH1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SASH1