SASH1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SASH1 Antibody [NBP1-85183] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: SASH1 Antibody [NBP1-85183] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SASH1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LLSAKSSTEPSLKSFSRNQLGNYPTLPLMKSGDALKQGQEEGRLGGGLAPDTSKSCDPPGVTGLNKNRRSLPVSICRSCETLEGPQTVDTWPRSH
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SASH1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SASH1 Protein (NBP1-85183PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SASH1 Antibody

  • dJ323M4
  • dJ323M4.1
  • KIAA0790RP3-323M4.1
  • PEPE1
  • Proline-glutamate repeat-containing protein
  • SAM and SH3 domain containing 1,2500002E12Rik
  • SAM and SH3 domain-containing protein 1
  • SH3D6A

Background

SASH1 (SAM and SH3 domain containing 1) was identified in an in silico analysis of loss of heterozygosity (LOH) to identify genes downregulated in breast cancer. Since this discovery, it has also been found to be a candidate tumor suppressor in colon cancer. Structurally, SASH1 contains two SAM (sterile alpha motif) domains and one SH3 domain indicating a role in signal transduction and as a signaling adapter.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SASH1 Antibody (NBP1-85183) (0)

There are no publications for SASH1 Antibody (NBP1-85183).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SASH1 Antibody (NBP1-85183) (0)

There are no reviews for SASH1 Antibody (NBP1-85183). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SASH1 Antibody (NBP1-85183) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SASH1 Products

Research Areas for SASH1 Antibody (NBP1-85183)

Find related products by research area.

Blogs on SASH1

There are no specific blogs for SASH1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SASH1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SASH1