LMO7 Antibody

Images

 
Western Blot: LMO7 Antibody [NBP1-83915] - Analysis in human cell line HeLa.
Immunocytochemistry/ Immunofluorescence: LMO7 Antibody [NBP1-83915] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol & actin filaments.
Immunohistochemistry-Paraffin: LMO7 Antibody [NBP1-83915] - Staining of human uterine cervix shows moderate nuclear and membranous positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: LMO7 Antibody [NBP1-83915] - Staining of human duodenum shows both membranous and nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: LMO7 Antibody [NBP1-83915] - Staining of human skeletal muscle shows moderate nuclear and cytoplasmic positivity in striated muscle fibers.
Immunohistochemistry-Paraffin: LMO7 Antibody [NBP1-83915] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LMO7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KIYGENGSKSMSDVSAEDVQNLRQLRYEEMQKIKSQLKEQDQKWQDDLAKWKDRRKSYTSDLQKKKEEREEIEKQALEKSKRSSKTFKEMLQDRESQNQKSTVPSRRRMYSFDDVLEEGKRPPTMTVSEASYQSERVEEKGATY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LMO7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:250 - 1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
LMO7 Protein (NBP1-83915PEP)
Publications
Read Publications using NBP1-83915.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%), Rat (83%). Reactivity reported in scientific literature (PMID: 22253135)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LMO7 Antibody

  • FBX20F-box only protein 20
  • KIAA0858FBXO20F-box protein Fbx20
  • LIM domain 7
  • LIM domain only 7
  • LIM domain only protein 7
  • LMO-7
  • LOMP
  • zinc-finger domain-containing protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84843
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87692
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80833
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
AF7829
Species: Hu
Applications: WB, IHC, ICC
H00011155-M06
Species: Hu
Applications: WB, ELISA, ICC/IF
H00009124-D01P
Species: Hu
Applications: WB, ELISA
AF4496
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-84841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6008
Species: Hu, Mu, Rt
Applications: WB
NBP2-15723
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-00597
Species: Hu, Mk
Applications: WB, Flow, ICC/IF
NBP1-89134
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
NBP1-26650
Species: Hu, Mu
Applications: WB, IP
NBP1-87745
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-25151
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF

Publications for LMO7 Antibody (NBP1-83915)(2)

Reviews for LMO7 Antibody (NBP1-83915) (0)

There are no reviews for LMO7 Antibody (NBP1-83915). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LMO7 Antibody (NBP1-83915) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LMO7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LMO7