Mucolipin 2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Mucolipin 2 Antibody [NBP1-89830] - Immunofluorescent staining of human cell line U-2 OS shows localization to intermediate filaments.
Immunohistochemistry-Paraffin: Mucolipin 2 Antibody [NBP1-89830] - Staining of human testis shows strong nuclear positivity in cells of ductus seminiferus.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Mucolipin 2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YHQLKDITLGTLGYGENEDNRIGLKVCKQHYKKGTMFPSNETLNIDNDVELDCVQLDLQDLSKKPPDWKNSSFFRLEFYR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MCOLN2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Mucolipin 2 Protein (NBP1-89830PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Mucolipin 2 Antibody

  • FLJ36691
  • mucolipin 2
  • mucolipin-2
  • TRPML2
  • TRP-ML2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-82375
Species: Hu, Mu, Rt
Applications: WB, Simple Western
NBP1-83791
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-41263
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NB120-19294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-78295
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-26650
Species: Hu, Mu
Applications: WB, IP
NB100-594
Species: Hu, Mu, Ca
Applications: WB, IHC-P
NBP2-59942
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-15083
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NB110-1244
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-80944
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-27109
Species: Hu, Mu, Po, Pm
Applications: WB, Simple Western, IHC, IHC-P
NB500-330
Species: Hu
Applications: B/N, Flow, IHC, IHC-P, IP, CyTOF-ready
NBP2-30564
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00010581-B01P
Species: Hu
Applications: WB, ELISA
NBP1-89830
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Mucolipin 2 Antibody (NBP1-89830) (0)

There are no publications for Mucolipin 2 Antibody (NBP1-89830).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Mucolipin 2 Antibody (NBP1-89830) (0)

There are no reviews for Mucolipin 2 Antibody (NBP1-89830). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Mucolipin 2 Antibody (NBP1-89830) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Mucolipin 2 Products

Bioinformatics Tool for Mucolipin 2 Antibody (NBP1-89830)

Discover related pathways, diseases and genes to Mucolipin 2 Antibody (NBP1-89830). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Mucolipin 2 Antibody (NBP1-89830)

Discover more about diseases related to Mucolipin 2 Antibody (NBP1-89830).
 

Pathways for Mucolipin 2 Antibody (NBP1-89830)

View related products by pathway.

Blogs on Mucolipin 2

There are no specific blogs for Mucolipin 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Mucolipin 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MCOLN2