MACC1 Antibody - BSA Free

Immunohistochemistry-Paraffin: MACC1 Antibody [NBP1-89352] - Immunohistochemical staining of human colon shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: MACC1 Antibody [NBP1-89352] - Immunohistochemical staining of human colorectal cancer shows moderate to strong cytoplasmic positivity in tumor cells.

Immunohistochemistry-Paraffin: MACC1 Antibody [NBP1-89352] - Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in renal tubules cells.

Immunohistochemistry-Paraffin: MACC1 Antibody [NBP1-89352] - Immunohistochemical staining of human stomach cancer shows moderate cytoplasmic positivity in tumor cells.

Simple Western: MACC1 Antibody [NBP1-89352] - Simple Western lane view shows a specific band for MACC1 in 0.2 mg/ml of RT-4 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: MACC1 Antibody [NBP1-89352] - Electropherogram image(s) of corresponding Simple Western lane view. MACC1 antibody was used at 1:20 dilution on RT-4 lysate(s).

• Reactivity: Hu
• Applications: Simple Western, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MACC1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MACC1 Antibody - BSA Free (NBP1-89352) is a polyclonal antibody validated for use in IHC and Simple Western. Anti-MACC1 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FRSGRIAQSMSEANLIDMEAGKLSKSCNITECQDPDLLHNWPDAFTLRGNNASKVANPFWNQLSASNPF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MACC1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Simple Western 1:20
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
  
  In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
  See Simple Western Antibody Database for Simple Western validation: Tested in RT-4, separated by Size, antibody dilution of 1:20, apparent MW was 93 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
• Control Peptide:

  MACC1 Protein (NBP1-89352PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25785098).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MACC1 Antibody - BSA Free

• metastasis associated in colon cancer 1
• SH3 domain-containing protein 7a5,7A5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MACC1 Antibody (NBP1-89352)(2)

Publications using NBP1-89352

• Koelzer VH, Herrmann P, Zlobec I et al. Heterogeneity analysis of Metastasis Associated in Colon Cancer 1 (MACC1) for survival prognosis of colorectal cancer patients: a retrospective cohort study. BMC Cancer 2015-03-21 [PMID: 25884643] (IF/IHC, Human)
• Ge Y, Meng X, Zhou Y et al. Positive MACC1 expression correlates with invasive behaviors and postoperative liver metastasis in colon cancer. Int J Clin Exp Med 2015-01-01 [PMID: 25785098] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: MACC1