MACC1 Antibody

Images

 
Immunohistochemistry-Paraffin: MACC1 Antibody [NBP1-89352] - Immunohistochemical staining of human colon shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: MACC1 Antibody [NBP1-89352] - Immunohistochemical staining of human colorectal cancer shows moderate to strong cytoplasmic positivity in tumor cells.
Immunohistochemistry-Paraffin: MACC1 Antibody [NBP1-89352] - Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in renal tubules cells.
Immunohistochemistry-Paraffin: MACC1 Antibody [NBP1-89352] - Immunohistochemical staining of human stomach cancer shows moderate cytoplasmic positivity in tumor cells.
Simple Western: MACC1 Antibody [NBP1-89352] - Simple Western lane view shows a specific band for MACC1 in 0.2 mg/ml of RT-4 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation ...read more
Simple Western: MACC1 Antibody [NBP1-89352] - Electropherogram image(s) of corresponding Simple Western lane view. MACC1 antibody was used at 1:20 dilution on RT-4 lysate(s).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications Simple Western, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MACC1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FRSGRIAQSMSEANLIDMEAGKLSKSCNITECQDPDLLHNWPDAFTLRGNNASKVANPFWNQLSASNPF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MACC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Simple Western 1:20
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Control Peptide
MACC1 Protein (NBP1-89352PEP)
Publications
Read Publications using
NBP1-89352 in the following applications:

  • IHC
    2 publications

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25785098).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MACC1 Antibody

  • metastasis associated in colon cancer 1
  • SH3 domain-containing protein 7a5,7A5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF527
Species: Mu
Applications: WB, IHC, Block, ICC
NBP1-80841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83701
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
AF2009
Species: Hu
Applications: WB, IHC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
H00001646-M03
Species: Hu
Applications: WB, ELISA
NBP2-50465
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Flow-CS
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6324
Species: Hu
Applications: WB
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
MAB4614
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-05164
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP1-60082
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-46231
Species: Hu
Applications: WB, IHC
NBP2-30036
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP1-89352
Species: Hu
Applications: Simple Western, IHC, IHC-P

Publications for MACC1 Antibody (NBP1-89352)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(2)
All Applications
Filter By Species
Human
(2)
All Species

Reviews for MACC1 Antibody (NBP1-89352) (0)

There are no reviews for MACC1 Antibody (NBP1-89352). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MACC1 Antibody (NBP1-89352) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MACC1 Products

Bioinformatics Tool for MACC1 Antibody (NBP1-89352)

Discover related pathways, diseases and genes to MACC1 Antibody (NBP1-89352). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MACC1 Antibody (NBP1-89352)

Discover more about diseases related to MACC1 Antibody (NBP1-89352).
 

Pathways for MACC1 Antibody (NBP1-89352)

View related products by pathway.

PTMs for MACC1 Antibody (NBP1-89352)

Learn more about PTMs related to MACC1 Antibody (NBP1-89352).

Blogs on MACC1

There are no specific blogs for MACC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MACC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MACC1