Sarcalumenin Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Sarcalumenin Antibody [NBP2-13378] - Staining of human cell line U-251 MG shows positivity in vesicles.
Immunohistochemistry-Paraffin: Sarcalumenin Antibody [NBP2-13378] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Sarcalumenin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ETEDANEEAPLRDRSHIEKTLMLNEDKPSDDYSAVLQRLRKIYHSSIKPL EQSYKYNELRQHEITDGEITSKPMVLFLGPWSVGKSTMINYLLGLENTRY QL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SRL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Sarcalumenin Protein (NBP2-13378PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Sarcalumenin Antibody

  • sarcalumenin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91745
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
H00009771-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5745
Species: Hu
Applications: WB, IHC
AF6387
Species: Hu
Applications: WB
AF2009
Species: Hu
Applications: WB, IHC
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P

Publications for Sarcalumenin Antibody (NBP2-13378) (0)

There are no publications for Sarcalumenin Antibody (NBP2-13378).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Sarcalumenin Antibody (NBP2-13378) (0)

There are no reviews for Sarcalumenin Antibody (NBP2-13378). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Sarcalumenin Antibody (NBP2-13378) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Sarcalumenin Products

Bioinformatics Tool for Sarcalumenin Antibody (NBP2-13378)

Discover related pathways, diseases and genes to Sarcalumenin Antibody (NBP2-13378). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Sarcalumenin Antibody (NBP2-13378)

Discover more about diseases related to Sarcalumenin Antibody (NBP2-13378).
 

Pathways for Sarcalumenin Antibody (NBP2-13378)

View related products by pathway.

PTMs for Sarcalumenin Antibody (NBP2-13378)

Learn more about PTMs related to Sarcalumenin Antibody (NBP2-13378).
 

Research Areas for Sarcalumenin Antibody (NBP2-13378)

Find related products by research area.

Blogs on Sarcalumenin

There are no specific blogs for Sarcalumenin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Sarcalumenin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SRL