SAP30BP Antibody

Images

 
Western Blot: SAP30BP Antibody [NBP2-38685] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: SAP30BP Antibody [NBP2-38685] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.
Immunohistochemistry: SAP30BP Antibody [NBP2-38685] - Staining of human kidney shows strong nuclear / nuclear membranous positivity in cells in tubules along with strong nuclear positivity in cells in glomeruli.
Western Blot: SAP30BP Antibody [NBP2-38685] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative Control. Lane 3: Overexpression lysate

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SAP30BP Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: QELVASFSERVRNMSPDEIKIPPEPPGRCSNHLQDKIQKLYERKIKEGMDMNYIIQRKKEFRNPSIYEKLIQFCAIDELGTNYP
Specificity
Specificity of human SAP30BP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SAP30BP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SAP30BP Protein (NBP2-38685PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SAP30BP Antibody

  • HCNGPDKFZp586L2022
  • HTRGHSV-1 binding
  • HTRPSAP30-binding protein
  • SAP30 binding protein
  • Transcriptional regulator protein HCNGP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00008819-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
H00004068-M01
Species: Hu
Applications: WB, ELISA
NBP1-86658
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, Flow-IC
AF2558
Species: Hu, Mu
Applications: WB, Simple Western
NBP1-30141
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-92131
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NBP1-89727
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-57362
Species: Hu
Applications: WB, ICC/IF
H00009354-M08
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-25162
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NBP2-46005
Species: Hu
Applications: WB, IHC, IF
NBP2-29951
Species: Hu, Mu
Applications: WB, Flow, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready

Publications for SAP30BP Antibody (NBP2-38685) (0)

There are no publications for SAP30BP Antibody (NBP2-38685).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SAP30BP Antibody (NBP2-38685) (0)

There are no reviews for SAP30BP Antibody (NBP2-38685). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SAP30BP Antibody (NBP2-38685) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for SAP30BP Antibody (NBP2-38685)

Discover related pathways, diseases and genes to SAP30BP Antibody (NBP2-38685). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SAP30BP Antibody (NBP2-38685)

Discover more about diseases related to SAP30BP Antibody (NBP2-38685).
 

Pathways for SAP30BP Antibody (NBP2-38685)

View related products by pathway.

PTMs for SAP30BP Antibody (NBP2-38685)

Learn more about PTMs related to SAP30BP Antibody (NBP2-38685).

Blogs on SAP30BP

There are no specific blogs for SAP30BP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SAP30BP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SAP30BP
Uniprot